PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004500G0050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 240aa    MW: 27024.5 Da    PI: 4.8786
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004500G0050genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB68.11.6e-21891386
            NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                     ++d  lP + + +i+k++lP + ++++da++++ ec +efi +++se+++ c r ++kti+++ +l al +lGf +y+e++ v 
  PH01004500G0050  8 KEDVSLPKSTMFKIIKEMLPPDVRVARDAQDLLVECCVEFINLLSSESNEVCSRGEKKTIAPEHVLKALEDLGFREYIEEVYVA 91
                     67999**************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-375137IPR009072Histone-fold
SuperFamilySSF471131.61E-349137IPR009072Histone-fold
PfamPF008082.2E-191276IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDIVGKSKED VSLPKSTMFK IIKEMLPPDV RVARDAQDLL VECCVEFINL LSSESNEVCS  60
RGEKKTIAPE HVLKALEDLG FREYIEEVYV AYEQHKLDTL DSPKASKFTG VEMTEEEAVA  120
EQQRMFAEAR ARMNNGAAKP KEPEPESHQQ PQQPPQSQAQ LHPQAQQPPQ PQLQLHPQPQ  180
QPPQMLLHPQ PQQPLQPQPQ LHSQPQQPPQ LQLQPQLQAQ PQPQPQPLSQ PQTEHGLDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B6e-34913012133Transcription Regulator NC2 beta chain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01004500G0050
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235094.11e-109nuclear transcription factor Y subunit beta
SwissprotP495924e-76NC2B_ARATH; Protein Dr1 homolog
TrEMBLI1I6Q31e-108I1I6Q3_BRADI; Uncharacterized protein
STRINGBRADI3G34930.11e-108(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-78nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]