PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004053G0150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 408aa    MW: 46031.5 Da    PI: 8.8605
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004053G0150genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.31.4e-100303992373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA+av++g  + a +lL++++ +asp+gd++qRla +f+e+L+arla+++s++y++l++++ts    +e l a++lf  ++ + k+++
  PH01004053G0150  30 HTLLVHCAKAVTDGR-RSAGELLKEIKRHASPTGDATQRLAYCFAEGLEARLAGTGSQVYRSLAAKRTS---AVEFLEAYQLFMSTCCFRKVAF 119
                      679********9975.6799********************************************99999...9********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqG..lQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        aN+aI +a+ g +r+Hi+D+++ qG  +QWp Ll+ L +R++gpp++RiT v+ p+ g   ++ + e+g+rL++ A+elgvpf++++    +
  PH01004053G0150 120 SFANKAIFNAAVGRSRLHIVDYGLHQGfgFQWPELLRWLGARDGGPPEVRITHVDLPQLGfrPANYMVEMGNRLTNCARELGVPFKYRA---AQ 210
                      ***********************9885337****************************99999*************************9...69 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                      ++++ +++L+++p+EalaVn  ++  +l+desv ++   +rd vL+ v +++P+v+v    + ++ ++ Fl rf eal yysalfd+l+a++pr
  PH01004053G0150 211 WQTVCVDDLSMEPDEALAVNDLFNFRTLMDESVVIDCpsPRDVVLNNVSKMQPDVFVQGTVNGSY-GTFFLSRFREALFYYSALFDMLDATMPR 303
                      ********************************97765559************************9.789************************* PP

             GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                      es+ r ++Er ++g+++ n++ace ++r+er et+++W+ r ++aG++++pls +++k a+ ++++++ + + +ee++++l++gWk+r L++ S
  PH01004053G0150 304 ESQPRLVLERDIFGWAALNAIACESEDRVERAETYKQWQVRNQRAGLRQLPLSRDIVKMARDMVKNHYHKDFVIEEDQQWLLQGWKGRILFAHS 397
                      ********************************************************************888*********************** PP

             GRAS 372 aW 373
                       W
  PH01004053G0150 398 TW 399
                      ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.5463380IPR005202Transcription factor GRAS
PfamPF035144.9E-9830399IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGNETGKKKR KGRKNKAPGS RGAAEVVDLH TLLVHCAKAV TDGRRSAGEL LKEIKRHASP  60
TGDATQRLAY CFAEGLEARL AGTGSQVYRS LAAKRTSAVE FLEAYQLFMS TCCFRKVAFS  120
FANKAIFNAA VGRSRLHIVD YGLHQGFGFQ WPELLRWLGA RDGGPPEVRI THVDLPQLGF  180
RPANYMVEMG NRLTNCAREL GVPFKYRAAQ WQTVCVDDLS MEPDEALAVN DLFNFRTLMD  240
ESVVIDCPSP RDVVLNNVSK MQPDVFVQGT VNGSYGTFFL SRFREALFYY SALFDMLDAT  300
MPRESQPRLV LERDIFGWAA LNAIACESED RVERAETYKQ WQVRNQRAGL RQLPLSRDIV  360
KMARDMVKNH YHKDFVIEED QQWLLQGWKG RILFAHSTWV ANGTTSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-43293995374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663691.10.0PREDICTED: scarecrow-like protein 14
SwissprotO809331e-130SCL9_ARATH; Scarecrow-like protein 9
TrEMBLW5ERC80.0W5ERC8_WHEAT; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-131GRAS family protein