PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003773G0220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 428aa    MW: 45831.9 Da    PI: 8.2897
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003773G0220genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.53e-41124200278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC+adls++++yhrrhkvCe+hsk+pvv++sg+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+q+
  PH01003773G0220 124 CAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVISGREMRFCQQCSRFHLLAEFDEAKRSCRKRLDGHNRRRRKPQP 200
                      **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-36116185IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.351121198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-38122203IPR004333Transcription factor, SBP-box
PfamPF031103.0E-31124197IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MLVLKALGVL GPLPHLLFLL LESLCRFLGT WPNWSTTPCP PSPPAASGIA AAAAARGSPN  60
RPECSVDLKL GGLGEFGAPD VLKEPAAKGP VVSVSIAAVV PSASSLKRPR SGPGGAGGGQ  120
CPSCAVDGCK ADLSKCRDYH RRHKVCEAHS KTPVVVISGR EMRFCQQCSR FHLLAEFDEA  180
KRSCRKRLDG HNRRRRKPQP DNMNSGSFMT SQQGTRFASF APPRPEMSWS GIIKSEDSPY  240
YTHQVLSNKQ HFVGSTSTYS KEGRRFPFLQ EGDQISFSTS ATLEISVCQP LLKTVAPPPE  300
SNSSNKIFSD GMTRLLDSDC ALSLLSSPVN SSSVDVSRMV QPTEHIPMAQ PLVPNLQFGS  360
SSWFACSQAS SGVSTAGFTC PSMESEQLNT VLVPSTNDNE MNYHGIFHVG AEGSSDGTSP  420
SLPFTWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-28114197184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180197KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01003773G0220
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803089.10.0squamosa promoter-binding-like protein 18 isoform X2
SwissprotQ0J0K11e-163SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A3S6H5L90.0A0A3S6H5L9_BAMML; Squamosa-promoter binding protein-like protein
STRINGBRADI4G34667.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-41SBP family protein