PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003178G0220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 385aa    MW: 41252.4 Da    PI: 9.7268
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003178G0220genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP46.78.4e-151261574778
                      SSEEETTT--SS--S-STTTT-------S--- CS
              SBP  47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       rfh l efDe krsCr+rL++hn+rrrk+q+
  PH01003178G0220 126 CRFHLLGEFDEVKRSCRKRLDGHNRRRRKPQP 157
                      59***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-478142IPR004333Transcription factor, SBP-box
PROSITE profilePS5114111.42679155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.51E-12126160IPR004333Transcription factor, SBP-box
PfamPF031104.1E-7127154IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MPSWDLGTVV GPSGVGALDL KLGAPTSWKA AAAPVPPPSA LAKRPRAGAV LGGGVHGRPV  60
QVPRVPPPAQ GLRGALQDAR RHRRRPAAAL LSTVQQLSRS GEFRFRPCIH GDLSWEILMI  120
GGIVLCRFHL LGEFDEVKRS CRKRLDGHNR RRRKPQPDPL NPGGLFANHH GATRFASYPQ  180
IFSTTSMAEH KWPASAVKTE TDAFQEQYYP ALHLNGAASL FHVKERKHFP FLTDHSDTAA  240
TAFSCQPFTI TPSSESSSNS SRHSNGKMFA QDGGLDNCAL SLLSDNPTPA QIMVPVAQSL  300
GGAGIQYGSV ARLPNDNDVS LTGLSYVRVE DKNTPILDTS TSHTATATTS SAAATQLQYH  360
GYYHVNADQG NSDGAIQALP FSSW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137154KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01003178G0220
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478842e-57KF447884.1 Triticum aestivum squamosa promoter-binding-like protein 23 (SPL23) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020178580.11e-109squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-102SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLA0A3Q8AL041e-162A0A3Q8AL04_9POAL; Squamosa-promoter binding protein-like protein
STRINGPavir.J02262.1.p1e-110(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.19e-17SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]