PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003147G0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Dof
Protein Properties Length: 294aa    MW: 30822.3 Da    PI: 8.361
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003147G0100genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77.1e-4055115262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  PH01003147G0100  55 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 115
                      7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3153113IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3356113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22759113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MMAGAPPMHI CMDSDWLKGI VPEEPGMGSS SPSAELIMCP RPMQAAADRR LRPQHDQPLK  60
CPRCESTHTK FCYYNNYSLS QPRYFCKTCR RYWTKGGSLR NVPVGGGCRK NKRASASKKA  120
VAAAVSPAPL HGRHMETGLH LSFSGMQLPP PAASADPLCS LGLLDWKYDP ILAGSGGAAA  180
AAAALERANS EAYFAGAGMM GIAAAGGGAD CHALSALRYA AGLGEHLALP FGATRAEHDA  240
VEMKPAAERL LSLEWCGEAS RVAPESSISS LSGLGLWSGM IGGAHHHHGS SAAI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1003500.0FP100350.1 Phyllostachys edulis cDNA clone: bphylf036a01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953626.11e-156PREDICTED: uncharacterized protein LOC101759372
TrEMBLA0A0A9D8K81e-157A0A0A9D8K8_ARUDO; Uncharacterized protein
STRINGSi017962m1e-156(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.16e-39Dof family protein