PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003146G0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 707aa    MW: 78388.1 Da    PI: 6.1921
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003146G0100genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.51.6e-943466972373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lLl+cA+avs++d + a++lL++++  +sp+gd+ qRla+yf+eAL+arla+++s+ly++l +++ts   +++ l+a++lf  ++ + k+++
  PH01003146G0100 346 HTLLLHCAQAVSTDDSRSASELLKQIKRSSSPRGDAAQRLAHYFAEALEARLAGTGSQLYQSLMVKRTS---VVDFLKAYQLFMAACCCKKVAF 436
                      679***************************************************************999...********************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                         N++I++av+g +r+Hi+D+++++G+QWp Ll+ LasR++gpp                  eetg+rL + A++lgvpf+f+  +a + e++
  PH01003146G0100 437 TFSNKTIYDAVAGRSRLHIVDYGLNYGFQWPGLLRGLASREGGPP------------------EETGRRLGNCAQQLGVPFKFHG-IAAKRETV 511
                      *******************************************98..................58********************.69999*** PP

             GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      ++e+L+++++E+l+V++  +  +l+de++  +s  +rd++L+ +++++P+v+++   + +++s+ Fl+rf e l +y+a fd lea++pr+s+e
  PH01003146G0100 512 RPEDLNIDRDEVLVVSSLCHFRHLMDENLVFDSpsPRDQILENIRKMRPDVFIHGIVNGSYGSAYFLTRFREVLFHYAAQFDLLEATVPRDSDE 605
                      ****************************98877779********************************************************** PP

             GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      r  vEr ++gr++ nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +   ++  + + + v+ +  +l+  Wk+r L+++S W
  PH01003146G0100 606 RLLVERDMFGRAALNVIACEGADRVERPETYKQWQVRNHRAGLTQLPLKPDVVKVVLDKVKDNYHKDFVVDGDGRWLLHRWKGRVLYALSTW 697
                      ***************************************************************9888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.285319678IPR005202Transcription factor GRAS
PfamPF035145.4E-92346697IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MATTPEEFLR EGILVRPEPP SPSVFLDLPP TPHGDAEDPA SFDDMVLPYV SRMLMEEGID  60
DHFFYEYPDH PALLQVQLPF AQILSSYGSN TTSSSGDGSS GNGNNTTLTL SPSSSSPVSP  120
SNAWPHDAVQ LSRPLHSPPY THTVAPGHDG RSTDIQGSAF FNGAEEDAKT VTFPGGNADQ  180
GMLSSGSDFF KGLFPGENME MLNSAFFKGM EEASKFLPRD SSLPIYHGAS SRELSPTDGK  240
PVRSFTAQRE VVDGMLGGGA HGGGRRKNRD KLEAEEGRAS KMITQETEED GAREMFDEMM  300
LHDHEICMKG VQDLRIAVDK DTEKKSSRKK ARPRRGASDS EMVDLHTLLL HCAQAVSTDD  360
SRSASELLKQ IKRSSSPRGD AAQRLAHYFA EALEARLAGT GSQLYQSLMV KRTSVVDFLK  420
AYQLFMAACC CKKVAFTFSN KTIYDAVAGR SRLHIVDYGL NYGFQWPGLL RGLASREGGP  480
PEETGRRLGN CAQQLGVPFK FHGIAAKRET VRPEDLNIDR DEVLVVSSLC HFRHLMDENL  540
VFDSPSPRDQ ILENIRKMRP DVFIHGIVNG SYGSAYFLTR FREVLFHYAA QFDLLEATVP  600
RDSDERLLVE RDMFGRAALN VIACEGADRV ERPETYKQWQ VRNHRAGLTQ LPLKPDVVKV  660
VLDKVKDNYH KDFVVDGDGR WLLHRWKGRV LYALSTWVAD DATSNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-373496978374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLW5E9X10.0W5E9X1_WHEAT; Uncharacterized protein
STRINGBRADI2G52227.10.0(Brachypodium distachyon)
STRINGBRADI4G09180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-124SCARECROW-like 14