PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003146G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 831aa    MW: 91385.9 Da    PI: 4.8296
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003146G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.88.6e-1074508212373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA+ v++gd + a++lL+++++++sp+gd++qRla++f+e+L+ rla+++s++y++l +++ts    +e l+a+kl+  ++ + ++s+
  PH01003146G0070 450 HTLLIHCAQSVATGDRRSANELLKQIKQHSSPRGDTTQRLAHCFAEGLEVRLAGTGSQVYRSLVAKRTS---AVEFLKAYKLYMAACCFKRVSF 540
                      679*************************************************************99999...9********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                          ++I++av+g +r+Hi+D+++++G+QWp Ll+ La+R++gpp++R+Tg++ p++g   + ++eetg+rL++ A+e+gvpf+f+  +a ++e
  PH01003146G0070 541 TFSIKTIYNAVAGRSRLHIVDYGVQYGFQWPGLLRLLAAREGGPPEVRLTGIDLPQPGfrPAFQIEETGRRLSNCAREFGVPFKFHN-IAAKWE 633
                      *********************************************************999***************************.799*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      +++ e+L+++p+E+l+Vn +  l +l+desv l+s  +rd vL+ +++++P+v++ +  +  ++++ F++rf eal +ysalfd+l+a++pre 
  PH01003146G0070 634 TIRAEDLNIDPDEVLVVNNQCGLNNLMDESVVLDSpsPRDVVLSNIRKMRPNVFIQCVVNGTYGAPFFVTRFREALFFYSALFDMLDATIPREC 727
                      ******************************99988889******************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      +er  +Er llgr + nv+acega+r+ r et+++W+ r ++aG+++++l+ ++++ a+  +++++ + + ++ ++ +l++gWk+r L+++S W
  PH01003146G0070 728 DERLLIERDLLGRCALNVIACEGADRVDRPETYKQWQVRNHRAGLRQLQLNPEVVQVARNKVKNHYHKDFVIDVDHRWLLQGWKGRVLYATSTW 821
                      ******************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.93423802IPR005202Transcription factor GRAS
PfamPF035143.0E-104450821IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MTATPEEFLR EGFLVDPEPL SPSLFLDLPP TPHSHADGED PVNSDDLVLP YISRMLMEED  60
IDDKFFYQYP DQPALLTAQQ PYAQILADTT SSSDSATNNT TNSGNSIGLS PSPDAPAPAN  120
PTWPYDPIEL SRLLQSPPYL DMRIGLADTT TNSGNSTGLS PSSSSPDAPA SANPTWPYDP  180
IELSQLLQSP PYLDMRIGLA DDVDNLFLPG DVAPSAGFQQ SPALDKGAAD DGNPSFAGAG  240
QNGGTTGIQS SALLNDTDEQ EVEAKTIISL PDGDSDQGAL ASAFFNGQTG SNMDMLNLAF  300
LKGMEEANKF LPTNNNLLID LEATSEKFLP RDSKPVSGFT AGRVKEEVVD GMPMFGGGTG  360
NGRGRKNRHD GDDLEAETGR NSKLLMPELE ETGAREMFDE IMLRGYEICM KGMEDLRIAM  420
GSEAEKKIRK GTVKAAARGS RGVSKVVDLH TLLIHCAQSV ATGDRRSANE LLKQIKQHSS  480
PRGDTTQRLA HCFAEGLEVR LAGTGSQVYR SLVAKRTSAV EFLKAYKLYM AACCFKRVSF  540
TFSIKTIYNA VAGRSRLHIV DYGVQYGFQW PGLLRLLAAR EGGPPEVRLT GIDLPQPGFR  600
PAFQIEETGR RLSNCAREFG VPFKFHNIAA KWETIRAEDL NIDPDEVLVV NNQCGLNNLM  660
DESVVLDSPS PRDVVLSNIR KMRPNVFIQC VVNGTYGAPF FVTRFREALF FYSALFDMLD  720
ATIPRECDER LLIERDLLGR CALNVIACEG ADRVDRPETY KQWQVRNHRA GLRQLQLNPE  780
VVQVARNKVK NHYHKDFVID VDHRWLLQGW KGRVLYATST WVADDNKSVF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-384538218374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1HSE90.0I1HSE9_BRADI; Uncharacterized protein
STRINGBRADI2G52227.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-150SCARECROW-like 14