PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003044G0090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 195aa    MW: 20421.8 Da    PI: 10.0894
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003044G0090genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.31.9e-4290166278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cq+e+C adlseak+yhrrhkvCe+hska+vvlv+gl+qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk++a
  PH01003044G0090  90 CQAERCGADLSEAKRYHRRHKVCETHSKAAVVLVAGLRQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKSSA 166
                      **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-3584151IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.29187164IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.85E-3988168IPR004333Transcription factor, SBP-box
PfamPF031103.7E-3290163IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDRKDKPRES SSAASMAALA AAAAAGDGAD VARADGMLPP SGEEDKKPKL VTVPMASVGA  60
SSSSAAAMAV RRGGAAGGAV AAGGGGGPSC QAERCGADLS EAKRYHRRHK VCETHSKAAV  120
VLVAGLRQRF CQQCSRFHEL SEFDDTKRSC RRRLAGHNER RRKSSAEAHG DGCRHADPDG  180
RSHPGNPPLN HFQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3881163284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01003044G0090
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0916720.0FP091672.1 Phyllostachys edulis cDNA clone: bphylf033o15, full insert sequence.
GenBankFP0944780.0FP094478.1 Phyllostachys edulis cDNA clone: bphyst005i03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560169.33e-69squamosa promoter-binding-like protein 13
SwissprotQ6Z4614e-55SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A3S6H7251e-135A0A3S6H725_9POAL; Squamosa-promoter binding protein-like protein
STRINGMLOC_13032.16e-74(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.25e-40squamosa promoter binding protein-like 4