PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002789G0180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 322aa    MW: 34362.4 Da    PI: 7.4797
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002789G0180genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP50.84.3e-161081404678
                      TSSEEETTT--SS--S-STTTT-------S--- CS
              SBP  46 CsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       srfh+l efDe+krsCr+rL++hn+rrrk+q+
  PH01002789G0180 108 SSRFHMLAEFDEGKRSCRKRLDGHNRRRRKPQH 140
                      69****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114113.1159138IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.9E-5106125IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.69E-13107143IPR004333Transcription factor, SBP-box
PfamPF031101.1E-8109137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MAHSVHVRLS LPLSAEAHEK ADPNSSGFLV ESGEAAVPVT GVGGGGGFDE TDDAPMMTEL  60
QRVDPNSSFH LRSTPSSMLS SSVGSSMRRR QGPQRASGGR RPLRVEASSR FHMLAEFDEG  120
KRSCRKRLDG HNRRRRKPQH DAMNPMSFFP YHQVNQFSVH RQTFPIADQN ADSFMHPLDR  180
QPPFSISFSG TLKAPKHFPF LQDGSSILST ARPALLQPFS SAEDGTTTTT TTTSTCNGLS  240
HALDPECALS LLSSSLHPSP AGIPSATVPT QFASSLARIA VASQAATTAF APDGAGGGDH  300
VLVPGAMFED PSQVLPFSWQ V*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120137KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002789G0180
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617950.19e-99putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-100SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A3S6H5I41e-135A0A3S6H5I4_9POAL; Squamosa-promoter binding protein-like protein
STRINGOPUNC11G11990.11e-101(Oryza punctata)
STRINGLPERR11G11330.11e-101(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-14SBP family protein