PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002691G0230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HD-ZIP
Protein Properties Length: 289aa    MW: 31676.8 Da    PI: 4.8856
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002691G0230genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.9e-1971124356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  PH01002691G0230  71 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 124
                      4557899**********************************************9 PP

2HD-ZIP_I/II124.45.1e-4070162193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL +++dal++e ++L++++++L++e++e
  PH01002691G0230  70 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALCARHDALRHECDALRHDKDALAAEIME 162
                      69**************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.4E-1864128IPR009057Homeodomain-like
SMARTSM003891.6E-1869130IPR001356Homeobox domain
PROSITE profilePS5007116.47170126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.7E-1971129IPR009057Homeodomain-like
CDDcd000864.56E-1671127No hitNo description
PfamPF000463.4E-1671124IPR001356Homeobox domain
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PfamPF021838.2E-14126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MKRPTCRGLS MASQKTTDQQ EDSRYMERQE VDGHGAAERD DVIVRAYDDE EEDEELAGGA  60
GGPGACGLGE KKRRLAAEQV RALERSFEAD NKLDPERKAR IARDLRLHPR QVAVWFQNRR  120
ARWKTKQIER DFAALCARHD ALRHECDALR HDKDALAAEI MELKGKVETQ MAVKLEATEE  180
RPSATAAAAG AAAVCKDWST DSDSSAVFNE EPSPYSGVAF DHHQPGFTGF TSFLASSSAL  240
SSSFPSLYHG SHLDQDDGLL GGASDELGGA GFFAEEHAAS LSWYGSEGW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002691G0230
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997530.0FP099753.1 Phyllostachys edulis cDNA clone: bphyem212a11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792352.11e-110homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z77e-96HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A3Q8H9651e-125A0A3Q8H965_FESAR; Class I homeodomain-leucine zipper protein 8
STRINGPavir.J35191.1.p1e-111(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-38homeobox protein 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]