PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002537G0110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Whirly
Protein Properties Length: 321aa    MW: 34928.9 Da    PI: 9.5116
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002537G0110genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly195.85.9e-61902272139
           Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                      +yk+kaal+++++ p+f+ ldsg+ k+ ++G++ll++a+a+++r+ydW +kq+f+ls+ e+++l+ l++ +sceffhdp+++ s+eGkvrk+lk
  PH01002537G0110  90 IYKGKAALSLDPRPPQFVPLDSGAYKVAKEGFVLLQFAPAVSPRQYDWTRKQVFSLSVWEMGSLLTLGPTDSCEFFHDPFKGRSDEGKVRKVLK 183
                      9********************************************************************************************* PP

           Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                      veP pdG G f+nlsv+n l++ +es+++P+sk+efav+ s ++
  PH01002537G0110 184 VEPTPDGNGRFFNLSVQNRLLNIDESIYIPISKGEFAVIVSTFN 227
                      ***************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.5E-7977249IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.88E-7382253IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.1E-5890224IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MPPPLSLSVP SPRPPLPPLS LHPKAPQALT LAAPPLSSRK PPPACSVASP RHSDYFDPRA  60
PPPRDGYGRP PPPPPSQGGQ DGRVFASYNI YKGKAALSLD PRPPQFVPLD SGAYKVAKEG  120
FVLLQFAPAV SPRQYDWTRK QVFSLSVWEM GSLLTLGPTD SCEFFHDPFK GRSDEGKVRK  180
VLKVEPTPDG NGRFFNLSVQ NRLLNIDESI YIPISKGEFA VIVSTFNYVI PHLMGWSTFT  240
NSIKPEDSRA YSRPDSQAYI LIKQVVVRNC AVQNVSAIWS CTGSYVGQQI SVLTYEAGAK  300
PPPNEVRYAD AAGKVLSADS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koq_A5e-90832448169Single-stranded DNA-binding protein WHY3, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8361940.0CT836194.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA048P18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964537.11e-137PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic isoform X1
SwissprotB2LXS71e-137WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLF2CQ931e-137F2CQ93_HORVD; Predicted protein
STRINGSi006951m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.22e-92ssDNA-binding transcriptional regulator