PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002384G0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Dof
Protein Properties Length: 250aa    MW: 25770.4 Da    PI: 10.2565
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002384G0100genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.42.1e-3567121660
           zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ +
  PH01002384G0100  67 EQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSARKRPR 121
                      68*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.51267121IPR003851Zinc finger, Dof-type
PfamPF027014.3E-3167119IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2268114IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MPGQVMEARL HQQLPPMPVA LTPPNWNHEA TTTAMAAATA AADVSCLQQV VPGNASANAV  60
AATGGREQCP RCASHDTKFC YYNNYNTSQP RHFCRACRRY WTLGGSLRNV PIGGSARKRP  120
RMAPPVVRRP PVHFGAPPPM PPPPSQQGLL GSLFALGAAS LLEGRVGFDL GLGLPGPGQV  180
GHAGAGEVGL HGLGLRGGSA GTSASLLWPT GLLENDSVDT WKVPVAAAGA ILAGVLRRGG  240
GSTGGRPASW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1000170.0FP100017.1 Phyllostachys edulis cDNA clone: bphylf059n05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559674.26e-66PREDICTED: dof zinc finger protein DOF1.7-like
TrEMBLA5HWF69e-84A5HWF6_HORVD; Dof zinc finger protein 7
STRINGBRADI1G14570.14e-57(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-24DOF zinc finger protein 1