PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002274G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family G2-like
Protein Properties Length: 463aa    MW: 49571.5 Da    PI: 6.5157
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002274G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31266321156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  PH01002274G0070 266 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 321
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.539263323IPR017930Myb domain
SuperFamilySSF466892.78E-17264324IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28264324IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-26266321IPR006447Myb domain, plants
PfamPF002499.7E-7268319IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MDSSPSDLTL DYKPNGGGGT VAGAYPMIIG KQAPLVDHHL TTEQATQKLQ ESLSRLEEER  60
LKIDAFRREL PLCMQLLNHA MEAYRQQLEA YQMGSQGGAA AARRPLVLEE FIPLKNIGID  120
EADKPGNPPS EKASWMVSAQ LWNGPAADTA ANGPQTPKEH SEHPLDTSPE FSALDGSAGQ  180
RNGGAFLPFS KDKAMAESAA LPKLALAPAE KDAIAGAGGE VDKMQYHDAG SNNGVASRRD  240
VQNGAKPTST TPEGQAAPMP PQSHRKARRC WSPELHRRFV NALQILGGAQ VATPKQIREL  300
MKVDGLTNDE VKSHLQKYRL HTRRPMTAPP TAAPAAPHLV VLGGIWVPPE YATQAAAPTI  360
YGAHPATQPH YTAAVAAQGY YQSPAAVHHP AAAMVHRAVA PPPPPAYKAA TRVVSPESEG  420
RGSGGGRERW ESIEEEREDD DDEEMAAAKA DAEENARRCR SN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002274G0070
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865721e-115BT086572.2 Zea mays full-length cDNA clone ZM_BFc0184N23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819732.10.0transcription factor NIGTH1
SwissprotQ5VRW21e-154NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A2S3HY880.0A0A2S3HY88_9POAL; Uncharacterized protein
STRINGSb03g004090.11e-178(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-78G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]