PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002205G0140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 458aa    MW: 48413.9 Da    PI: 9.1629
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002205G0140genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS238.92.2e-7313245630373
             GRAS  30 laspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGl 123
                       a+++gd+ qRl+a+++ AL +r+ +     ++  p+++ ++    e+ aa +l+++vsP++ ++   aN +Ileav+ ++++H +Dfd+s  +
  PH01002205G0140 132 AANQRGDAEQRLVAMMVCALYSRVGS-----AAPAPSQHLADLCGGEQRAACQLLHDVSPCFGLALHSANLTILEAVSDHRAIHLVDFDVSA-A 219
                      478899*******************9.....444455555555588999999**************************************85.8 PP

             GRAS 124 QWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrl 213
                      Q +aL++aLa+R+ ++ sl++T+v +p+s      +++l +t erL+k+A++ g++f+fn+ ++ r +++e ++L ++pgEalaVnl+++l r+
  PH01002205G0140 220 QHVALIKALADRRVPATSLKVTAVMDPTSPftpsLTQALTATSERLKKIAQQAGLDFRFNA-ISCRAAEIEASRLGCEPGEALAVNLAFALSRV 312
                      **************************99888998899************************.6889**************************** PP

             GRAS 214 ldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerre 307
                      +desvs +++rde+L+              +e+++n++++++rf++a+ +y a+++sl+a+l+r+s er+  E++ l++++ n+v  ega+r+e
  PH01002205G0140 313 PDESVSPANPRDELLR--------------RELNTNTAPLAARFSDACAHYGAVLESLDATLGRDSAERARAEAA-LANKVANAVGLEGADRVE 391
                      *************998..............79******************************************9.9***************** PP

             GRAS 308 rhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      r+e ++kWr+r+++aGF+pvpl++++a  +k+        g+ v+ +sg l  gW++r ++++SaW
  PH01002205G0140 392 RCEVFGKWRARFGMAGFRPVPLGQDIAYRVKARFGPAR-PGFDVKPDSGRLGVGWNGRVVTVTSAW 456
                      **********************************9999.9************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.23577438IPR005202Transcription factor GRAS
PfamPF035147.5E-71132456IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MEPAGAPWCD PRRGYGYGVG SAVQAPMRQQ QPRSDIVAGA AVSGGGVLKR SLGEMERWEH  60
QRQVATQHAL YMRAVRQRTA AQSAFSPLNL GAVLGGARSP ASGFSGSSSF GGLSQQPSST  120
LSSLTTAPRM NAANQRGDAE QRLVAMMVCA LYSRVGSAAP APSQHLADLC GGEQRAACQL  180
LHDVSPCFGL ALHSANLTIL EAVSDHRAIH LVDFDVSAAQ HVALIKALAD RRVPATSLKV  240
TAVMDPTSPF TPSLTQALTA TSERLKKIAQ QAGLDFRFNA ISCRAAEIEA SRLGCEPGEA  300
LAVNLAFALS RVPDESVSPA NPRDELLRRE LNTNTAPLAA RFSDACAHYG AVLESLDATL  360
GRDSAERARA EAALANKVAN AVGLEGADRV ERCEVFGKWR ARFGMAGFRP VPLGQDIAYR  420
VKARFGPARP GFDVKPDSGR LGVGWNGRVV TVTSAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-3313245632374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0K3N20.0A0A0E0K3N2_ORYPU; Uncharacterized protein
STRINGORGLA02G0240700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-72SCARECROW-like 8