PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002148G0200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 931aa    MW: 102981 Da    PI: 9.5682
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002148G0200genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.7e-09394438246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v++ G+++W  Ia  +g++Rt+ qc sr+q 
  PH01002148G0200 394 NAWTAREEKRLILIVQERGMHNWINIAVALGTHRTPFQCLSRYQR 438
                      68*****************************************96 PP

2Myb_DNA-binding35.42.5e-11447491248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +WT+eEd +l   v+ +G + W ++++ +  gR ++qc +rw+k l
  PH01002148G0200 447 RSWTKEEDHQLQASVETFGCN-WQLVSASLV-GRIGNQCSNRWRKTL 491
                      68*****************88.*********.************975 PP

3Myb_DNA-binding46.49e-15499544248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+ +Ed++l   vk lG+g+W++Ia+ ++ gRt  qc +rw+++l
  PH01002148G0200 499 GRWSLDEDKRLMVSVKILGSGSWNKIAQFVP-GRTQSQCNERWRNVL 544
                      8******************************.************986 PP

4Myb_DNA-binding33.97.1e-11551593245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      g+W +eEd +l+  v + G+  W++Ia  m  +Rt+++c  rw+
  PH01002148G0200 551 GKWRPEEDSKLLASVSEVGPC-WSKIAGAMIPHRTDNMCMRRWR 593
                      79*****************88.*****99999***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0016293389IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-10296312IPR009057Homeodomain-like
CDDcd001670.00151358385No hitNo description
Gene3DG3DSA:1.10.10.601.1E-10359400IPR009057Homeodomain-like
PROSITE profilePS500905.599362385IPR017877Myb-like domain
PROSITE profilePS500908.722388440IPR017877Myb-like domain
SMARTSM007171.1E-6392442IPR001005SANT/Myb domain
SuperFamilySSF466894.93E-21392487IPR009057Homeodomain-like
PfamPF139216.1E-12396457No hitNo description
Gene3DG3DSA:1.10.10.601.6E-13401448IPR009057Homeodomain-like
PROSITE profilePS5129418.321441495IPR017930Myb domain
SMARTSM007179.4E-10445493IPR001005SANT/Myb domain
CDDcd001671.94E-7448491No hitNo description
Gene3DG3DSA:1.10.10.604.6E-15449491IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-17495544IPR009057Homeodomain-like
PROSITE profilePS5129416.624496548IPR017930Myb domain
SMARTSM007174.9E-11497546IPR001005SANT/Myb domain
SuperFamilySSF466893.31E-25497592IPR009057Homeodomain-like
PfamPF002499.9E-14499544IPR001005SANT/Myb domain
CDDcd001671.61E-10500544No hitNo description
Gene3DG3DSA:1.10.10.609.2E-15545599IPR009057Homeodomain-like
SMARTSM007172.0E-9549598IPR001005SANT/Myb domain
PROSITE profilePS5129411.011551600IPR017930Myb domain
PfamPF002494.2E-9551593IPR001005SANT/Myb domain
CDDcd001679.63E-9552593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 931 aa     Download sequence    Send to blast
MDFYSDDSDP DIDEDLQKDL DALRRSCILS GNDPEAAVAQ VSSYLSAPAS FTSAVAAADN  60
GSSDDDDEDL ALVRSIRENL HLNKASPSSP LPDPASSPRP ICVWPPSDTD DDDDDLETLH  120
AIQRRFSHYH SGTSTGSPKN MKTEASKGGD RELIAHRPGE EFDGEKQNAK ALSQTGFPKA  180
ALLLVDALKK NRTCQKFIRR KMINIEAKIE ENKDLRDRVK CLMDYQLSCR KSFGRILCQK  240
EDPRVRLISS RKPSAQSSKN KDKKIPALFL GPAENPHVSK YKMVLRQFPV LLQKQLWSDV  300
EKDKLAKGIK QQYQETLILD SMNNGSSTGD FSAVDMAYAL TNTAGNFEVT PESLRSVLPL  360
INWDKISAMY LPGRSGAECE SRWLNCDDPL INHNAWTARE EKRLILIVQE RGMHNWINIA  420
VALGTHRTPF QCLSRYQRSL NPHILKRSWT KEEDHQLQAS VETFGCNWQL VSASLVGRIG  480
NQCSNRWRKT LIPERTRVGR WSLDEDKRLM VSVKILGSGS WNKIAQFVPG RTQSQCNERW  540
RNVLDPDIDL GKWRPEEDSK LLASVSEVGP CWSKIAGAMI PHRTDNMCMR RWRFLCRDEL  600
PSVKAAIQIK KSIFLSNFVD REIERPAIAP SDLMSLVHTK VDRGDENTVR SRSKKQTEEN  660
LAVPDGVNNS SSGYSAARNR RKSTTDNNEV VQKRMRGSIS VDNEAALEIM GGSISVGNEV  720
ATKRTRGSTS VGKEGTVKKR TRGPASGKER GSISVGNEGT VKKRMRGSIS VGDEGAVKNR  780
MSGSVSIDRH GGATKRKRAP SRKSAKDNLT ADCTANAVSE LDLPSVPSEE RDVDTGNVNK  840
GRRKSTPRPK QINMTEGAAD KYSTCTRLAG CMSFARRNGN NRNKKHSNSS AKPLSSAMQS  900
SGPSGEDSQA PTMTISAGSD PTYVENGSTA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-253655923155MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-253655923155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647437.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647436.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647435.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647433.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647432.10.0PREDICTED: myb-like protein L isoform X1
TrEMBLA0A0E0LGZ50.0A0A0E0LGZ5_ORYPU; Uncharacterized protein
STRINGBGIOSGA024846-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g04700.10.0(Oryza sativa Japonica Group)
STRINGORGLA07G0021600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-144myb domain protein 4r1