PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002114G0160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family G2-like
Protein Properties Length: 243aa    MW: 25414.4 Da    PI: 9.9283
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002114G0160genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-3288141255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  PH01002114G0160  88 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 141
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.78E-1685142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-2986142IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-2488141IPR006447Myb domain, plants
PfamPF002493.2E-789140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MAWPSSVCSS SPAQVPPPSL DPAAAFLSPS AYHRMLSSTG RLHGVLADTL RGYGAGMGAL  60
GLGGQPFGLA SSRFTHKHPA SRRSMRAPRM RWTSTLHARF VHAVELLGGH ERATPKSVLE  120
LMDVKDLTLA HVKSHLQMYR TVKSTDHKPA ASSGPMDGSG SGGDDDLPVS ARQASSGGDM  180
NPRLFTDHQS SSEGAASPGG GTGGGDVDCS SAAVNSDTTV RSTSSRYKWE KMPGLWYTKG  240
HS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-1789143357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002114G0160
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865272e-74DQ286527.1 Zea mays KANADI1-like protein (kan1a) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572210.19e-86probable transcription factor RL9
SwissprotQ0J2353e-59ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0Q3ID312e-84A0A0Q3ID31_BRADI; Uncharacterized protein
STRINGBRADI3G36260.12e-86(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-31G2-like family protein