PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002098G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family G2-like
Protein Properties Length: 150aa    MW: 15661.3 Da    PI: 6.8903
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002098G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.69.1e-31152455
          G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +rWt++LH+rF++ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  PH01002098G0070  1 MRWTSTLHARFIHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
                     79*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015572.7E-23152IPR006447Myb domain, plants
PROSITE profilePS512949.954155IPR017930Myb domain
SuperFamilySSF466893.58E-14153IPR009057Homeodomain-like
PfamPF002493.9E-7151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-26153IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MRWTSTLHAR FIHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKSTDKPA  60
ASSGPTDGGS GDEDFPGAGQ AASGGDNNMF LSRPFAEHRS TSEGAASSVG GDMDQSSAGN  120
TSTRWSNSSR FLGSGHCPLL SVSLALSQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-17154558Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01002098G0070
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3771031e-122AK377103.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3148F08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804688.13e-77probable transcription factor RL9
SwissprotQ0J2352e-56ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A2S3GZH96e-76A0A2S3GZH9_9POAL; Uncharacterized protein
STRINGBRADI4G29700.15e-77(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-41G2-like family protein