PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001953G0120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family VOZ
Protein Properties Length: 590aa    MW: 64794.4 Da    PI: 4.9583
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001953G0120genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4099.4e-1262474651217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p+ps++lgpkcalwdc r ++gse++qdyc+ +ha laln+ gl+gt+pv+rp+gidlkdg+lfaal ak+qgk+vgip+cegaat+kspwna+
  PH01001953G0120 247 PSPSQYLGPKCALWDCGRLVRGSEECQDYCNPYHAGLALNDdGLLGTRPVMRPRGIDLKDGPLFAALCAKIQGKNVGIPVCEGAATSKSPWNAP 340
                      89**************************************9799************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfd+sll ge++rewlffd+prrafesgnrkqrslpdysgrgwhesrkqvmk+fgglkrsyymdpqp+s +ewhl+eyein++da+alyrlel
  PH01001953G0120 341 ELFDISLLGGESLREWLFFDTPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKDFGGLKRSYYMDPQPASDYEWHLFEYEINDSDAIALYRLEL 434
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvsk.dsladlqkklgrlta 217
                      k +d+k+sak+k+++ +sl+++q++++rl+a
  PH01001953G0120 435 KFSDAKRSAKSKLAStSSLNEIQQQMVRLSA 465
                      ************975278***********97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MAGDPSSGGG GHGSAPGKGS RSSSRHRQFR DRAKTRVDDL QEMFSGLQSA RKDSRPADAA  60
LLEEQNSQGN NREASDPPLE TLRLLQLAVA EEEDDATSKL VIPRSTLPMP PSHESHGHGQ  120
DIQNLNPELQ VQGEAVVGGT TMLQQSLGQE MQGDCGASAM LHEQMYYIDH ELSIDDFLRD  180
DDYKINLPGS NPDGHNNLQG IDQLEHQQFN LPLDLPPPNS YVDANNSAQN TGDVFFHTSD  240
LLTTVCPSPS QYLGPKCALW DCGRLVRGSE ECQDYCNPYH AGLALNDDGL LGTRPVMRPR  300
GIDLKDGPLF AALCAKIQGK NVGIPVCEGA ATSKSPWNAP ELFDISLLGG ESLREWLFFD  360
TPRRAFESGN RKQRSLPDYS GRGWHESRKQ VMKDFGGLKR SYYMDPQPAS DYEWHLFEYE  420
INDSDAIALY RLELKFSDAK RSAKSKLAST SSLNEIQQQM VRLSADSPVE NKRAARGRPK  480
SNQKDSNANT YPASLAYQAV SPNTPNPVSA SSAYQAVSPN TPNQVSASNA YQALSLNTPN  540
QVNAPNAYQA VSQVDKMTFL NENAVYGPHL PYGYSTERSD FYWNPSDET*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001953G0120
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0690760.0AK069076.1 Oryza sativa Japonica Group cDNA clone:J023004H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640409.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-131VOZ1_ARATH; Transcription factor VOZ1
TrEMBLQ75IJ90.0Q75IJ9_ORYSJ; Uncharacterized protein
STRINGOS05T0515700-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-120vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]