PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001881G0390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family G2-like
Protein Properties Length: 388aa    MW: 41078.6 Da    PI: 4.7169
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001881G0390genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like46.67.5e-152312632254
          G2-like  22 GGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                      G +++AtPk+i+elmkv+gLt+++vkSHLQ Y 
  PH01001881G0390 231 GSNNVATPKQIRELMKVDGLTNDEVKSHLQEYA 263
                      66789**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-11230264IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-12231263IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MDSSPSDLTL DYKPNGGGGT AAGAYPMIIP KQAPPIVDGH HLTTEQATQK LQEFLSRLEE  60
ERLKIDAFKR ELPLCMQLLN HAMEAYRQQL EAYQMESQGG AAAARPLVLE QFIPLKNIGI  120
DAADKPGNPP SEKASWMVSA QLWNGPAADT AAKGPQTPKE HSEHPLDTSP KLSALDGGSG  180
QRNGGAFLPF SKDKAMAESA ALPELALAPA EKDAIAGAGA EVDKKPYHDA GSNNVATPKQ  240
IRELMKVDGL TNDEVKSHLQ EYATQAGAPA IYGAHPATQP HYTAAVAAQE YYQSHAAVHH  300
LQHHPAAAMV HRAVAPPPPP AYKAAAMVGS PESEGRGSGD GRERSESIEE EGEGEEREEE  360
EDDDEMAALA AKADAEENAA GAGVIKY*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001881G0390
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0842781e-101BT084278.2 Zea mays full-length cDNA clone ZM_BFb0097M01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020184511.11e-120myb family transcription factor EFM
SwissprotQ5VRW22e-88NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A3L6SLE01e-130A0A3L6SLE0_PANMI; Putative transcription factor GLK2
STRINGSb03g004090.11e-112(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-37G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]