PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001853G0340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 323aa    MW: 34301.9 Da    PI: 8.4072
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001853G0340genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.22e-22174222149
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                      +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCs  
  PH01001853G0340 174 RCQAEGCKADLSGAKHYHRRHKVCEYHAKAAVVVAGGKQQRFCQQCSSL 222
                      6*********************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.0E-25167222IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.725172248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-22173222IPR004333Transcription factor, SBP-box
PfamPF031102.0E-17175223IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MMSGRLNTAT SVTSDDFPFA AMQPPPYVGF EHGMAVGGAG QRPGGMQHHL YDNIDFAAAA  60
AAAATLQFQE QHQLLTLPPN GLPMAPPPMP MPLQMPMPMP GMPGDVYSAL GIVKREGGGG  120
PDVGGGAGRI GLNLGRRTYF SPGDMLAVDR LLMRSRLGGV FGLGFGGAHH QPPRCQAEGC  180
KADLSGAKHY HRRHKVCEYH AKAAVVVAGG KQQRFCQQCS SLERDQVDHL IEHERDQLPA  240
GPEQGGKANP HARRAAGEGG PPAQHHAPSP GRPSPSGAAL HSLPCAEQQH LVMLFSVLQR  300
VAVGERGGVR PEQQHQQQQQ QW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-16175220651squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001853G0340
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057601e-120AP005760.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:B1047G05.
GenBankAP0149621e-120AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126141e-120CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.12e-78squamosa promoter-binding-like protein 10
SwissprotA2YFT92e-62SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE82e-62SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A3Q8B7S41e-107A0A3Q8B7S4_BAMML; Squamosa-promoter binding protein-like protein
STRINGSi006559m7e-78(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.24e-20squamosa promoter binding protein-like 8