PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001834G0370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 412aa    MW: 43720.4 Da    PI: 8.4928
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001834G0370genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.74.4e-40184260177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cq+egC+adls ak+yhrrhkvCe h+ka++v+  g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk++
  PH01001834G0370 184 RCQAEGCKADLSAAKHYHRRHKVCEYHAKAAAVASGGKQQRFCQQCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKPA 260
                      6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-34178246IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.035182259IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-37183261IPR004333Transcription factor, SBP-box
PfamPF031102.3E-30185258IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MMSSRLNTGT IAPAADVVAD FAYAPMQPYV GFEPGMAMPS DRPPLLQHHL YDSLDFAAAA  60
FPFQEPALLS GSAPSGLQPL APQITMPMAP SSLQQVPMMT LPGVPTAADV YPFGACGLVK  120
REDGPVVNVG GGRIGLNLGR RTYFSPADVL AVDRLLMRSQ LGGVGAMGVL GLGLGAAHRH  180
QPPRCQAEGC KADLSAAKHY HRRHKVCEYH AKAAAVASGG KQQRFCQQCS RFHVLAEFDE  240
AKRSCRKRLT EHNRRRRKPA GTQAKDSPPP SKKADASITC SYTSDHKTAS ATAASKSTAI  300
SPNASGISCL ELDNGQASNA AAAPTLSLAA PHGKDGLDTM PMMQQVQGRE EQQHFMMTSL  360
VQSSSHQHNS SSNDRGIGNI LSCSSDQQNS SCNVGSNNNS SSMHFFEVDF M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281852581184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241258KRSCRKRLTEHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001834G0370
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478821e-149KF447882.1 Triticum aestivum squamosa promoter-binding-like protein 21 (SPL21) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020149100.11e-157squamosa promoter-binding-like protein 5
SwissprotQ0E3F82e-84SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A3Q8B3780.0A0A3Q8B378_BAMOL; Squamosa-promoter binding protein-like protein
STRINGMLOC_51510.11e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-40squamosa promoter binding protein-like 8