PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001685G0440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 195aa    MW: 21257.2 Da    PI: 8.3299
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001685G0440genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP113.31.4e-3561136176
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                      +Cqv+gCead+ e+k yhrrh+vC  +++a++v+++++++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  PH01001685G0440  61 RCQVPGCEADIRELKGYHRRHRVCLRCAHAAAVMLDDVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 136
                      6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-2755123IPR004333Transcription factor, SBP-box
PROSITE profilePS511412959136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3360139IPR004333Transcription factor, SBP-box
PfamPF031104.0E-2762136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MVPCACPEVD EMAAAAEVED VATELLAGAR KKSDAARGGG AAAGGGGGSG GAGRGAAAEM  60
RCQVPGCEAD IRELKGYHRR HRVCLRCAHA AAVMLDDVQK RYCQQCGKFH ILLDFDEDKR  120
SCRRKLERHN KRRRRKPDSK GTLEKEIDEQ LELSADGSGD GELREAKMIF TLDRTSLTRT  180
MKYLGNMNFF LNPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-4061141585squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118136KRSCRRKLERHNKRRRRKP
2122134RRKLERHNKRRRR
3129136NKRRRRKP
4130135KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001685G0440
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2503121e-120AK250312.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf72c21, mRNA sequence.
GenBankAK3635451e-120AK363545.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2016I24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656292.21e-86squamosa promoter-binding-like protein 9
SwissprotQ6I5765e-87SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A1D6FQB32e-87A0A1D6FQB3_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
TrEMBLA0A1D6FQB43e-88A0A1D6FQB4_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
STRINGGRMZM2G109354_P013e-88(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.31e-29squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]