PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001655G0060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 183aa    MW: 19207.3 Da    PI: 6.788
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001655G0060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.93.1e-5833129197
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdrflPian+srimkk++Pan+ki+kd+ketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplk+yl+kyre+e
  PH01001655G0060  33 VREQDRFLPIANISRIMKKAIPANGKIAKDSKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKAYLQKYREME 126
                      69******************************************************************************************** PP

            NF-YB  95 gek 97 
                      g++
  PH01001655G0060 127 GDS 129
                      *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.3E-5432137IPR009072Histone-fold
SuperFamilySSF471131.02E-3936133IPR009072Histone-fold
PfamPF008081.7E-2739103IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-226785No hitNo description
PROSITE patternPS0068507086IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-2286104No hitNo description
PRINTSPR006151.7E-22105123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MADAPASPGG GGGSHESGSP RGGGGGGGGG WGVREQDRFL PIANISRIMK KAIPANGKIA  60
KDSKETVQEC VSEFISFITS EASDKCQREK RKTINGDDLL WAMATLGFED YIEPLKAYLQ  120
KYREMEGDSK LSAKAGDGSV RKDAVGPHGG ASSSSAQGMG QQGAYNQGMG YMQPQYHNGD  180
ISN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B2e-4931124194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4931124194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001655G0060
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0983150.0FP098315.1 Phyllostachys edulis cDNA clone: bphylf037i08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961814.11e-103nuclear transcription factor Y subunit B
RefseqXP_004961815.11e-103nuclear transcription factor Y subunit B
RefseqXP_012700237.11e-103nuclear transcription factor Y subunit B
SwissprotP252091e-102NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLA0A2T7ECR31e-102A0A2T7ECR3_9POAL; Uncharacterized protein
STRINGPavir.J02009.1.p1e-103(Panicum virgatum)
STRINGSi023400m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-68nuclear factor Y, subunit B8
Publications ? help Back to Top
  1. Li XY, et al.
    Evolutionary variation of the CCAAT-binding transcription factor NF-Y.
    Nucleic Acids Res., 1992. 20(5): p. 1087-91
    [PMID:1549471]