PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001631G0530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 810aa    MW: 87600.3 Da    PI: 4.8933
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001631G0530genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB151.41.7e-476377191597
            NF-YB  15 rimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                       imkk+lPanakiskdaket+qecvsefisf+t+easdkcqrekrkt+ngddllwa++tlGfedyveplk yl+k+re+ege+
  PH01001631G0530 637 SIMKKALPANAKISKDAKETMQECVSEFISFITGEASDKCQREKRKTVNGDDLLWAMTTLGFEDYVEPLKNYLHKFREIEGER 719
                      69******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-13269330IPR009057Homeodomain-like
SuperFamilySSF1097152.22E-11273328No hitNo description
PfamPF087669.1E-8275328IPR014876DEK, C-terminal
SuperFamilySSF471135.8E-33636739IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.6E-44637736IPR009072Histone-fold
PfamPF008081.6E-21638693IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.7E-19657675No hitNo description
PROSITE patternPS006850660676IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.7E-19676694No hitNo description
PRINTSPR006155.7E-19695713No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MGCANGAGAG VGEDRSKIGD PFYQVSDLKE QILQLAGLAC HEEEEKSRTE LLEKLRTCNK  60
YTLVELCRSF DIPGSTAYKK AELVAIVMEF LMEHCSGIGG TNPDKKFKKR RRKREGTNLS  120
GGKPLKKKKP DGAALETHGE EKVDGRKGEE DRTNYSEFDL KDNRNECADN KKGQFPKEEA  180
NPEPSERVNG SMSENLDGVA LTEVPIPTNE QVLVTTPSAK LVSNIEGDNT NIKVPRKKNT  240
SITKKKATAK TDRKNKPCGK QMSRGDAKPQ QAVKPNRDEL RQAVLIILDT TDFATMTFGE  300
VVKQVDKYFG KDLFERKPLI MSLIEEELFR LAEEAEKKEL EEEEAAEAKA RAEQAGKERA  360
KDGRVESDID KANELEAGQD GKSKDAARNE NGNTIEKGVK GGISVKAAEN RNSDATPAES  420
SQDGKAEDGV NEKNSDEFTK DGKAEKVVQI ENGDNGVEAS RDGKAETAKE NDNGDTVEGP  480
EYGKTEEASD AENGDTEDGR SRRTEECRSG NGGNNAEDVN DFEAEEPNSN ENGGHVECAE  540
DGNNENGGNT VSHDAKCGKA KEAMENVSTE QSTDAVDDDK AEDAEHNANT KVDVDSKEGV  600
SEWGWRRCRT RTTTPAGRAT REGSCRRRGS RTGSCRSIMK KALPANAKIS KDAKETMQEC  660
VSEFISFITG EASDKCQREK RKTVNGDDLL WAMTTLGFED YVEPLKNYLH KFREIEGERA  720
AASSGGAASS TQQQAEMPRN TNASGYAGYG GAGPGPGGMM MMMGQPMYGS PPPPPPHQMA  780
MGGRGGFGQQ GGGGGGSSSS SGLGRQDRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-346387141692Transcription factor HapC (Eurofung)
4g92_B3e-346387141692Transcription factor HapC (Eurofung)
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112KKFKKRRRK
2107112KKRRRK
3107113KKRRRKR
4111128RKREGTNLSGGKPLKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001631G0530
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0931480.0FP093148.1 Phyllostachys edulis cDNA clone: bphylf024h17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228508.10.0uncharacterized protein DDB_G0290685
TrEMBLI1H4M50.0I1H4M5_BRADI; Uncharacterized protein
STRINGBRADI1G60040.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-46nuclear factor Y, subunit B3