PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001480G0290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TCP
Protein Properties Length: 245aa    MW: 25106 Da    PI: 5.8126
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001480G0290genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP104.12.4e-323197672
              TCP  6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72
                      r+ ++hTkv+gR+RR+R+ a caar+ +L++ LG+++d++ti WLlqq++pai ++tgt++ +a +
  PH01001480G0290 31 PRNRDRHTKVEGRGRRIRMAAACAARVAQLTRDLGHKSDGETIRWLLQQSEPAIVAATGTGTVPAIA 97
                     6999********************************************************9888833 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.4E-263398IPR005333Transcription factor, TCP
PROSITE profilePS5136923.9043387IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGPTGSHGSV VPKPEPVPVE FLGGLTVAPP PRNRDRHTKV EGRGRRIRMA AACAARVAQL  60
TRDLGHKSDG ETIRWLLQQS EPAIVAATGT GTVPAIATPV DGVLRIPTDG LAPVSAASAP  120
TGGGIPFIAI PAPGSGAAGD GKQQMMPPAA VWMVPQPPGG AGAANQPTHY WAFQTNPELI  180
NFAGAQPINV SNFHHQAFYG AEHLVAGGES QDQHPGGQKA SVVDQPQGEE GDYDGEAMTD  240
SSSE*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001480G0290
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061755e-75AP006175.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0669G04.
GenBankAP0149655e-75AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126175e-75CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576745.11e-101transcription factor PCF2
SwissprotA2YXQ15e-50PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH65e-50PCF2_ORYSJ; Transcription factor PCF2
TrEMBLI1IRY81e-100I1IRY8_BRADI; Uncharacterized protein
STRINGBRADI4G35520.11e-101(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.27e-23TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]