PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001459G0190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family G2-like
Protein Properties Length: 551aa    MW: 60476 Da    PI: 5.2158
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001459G0190genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.21.1e-34216270155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  PH01001459G0190 216 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 270
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.967213273IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-32214272IPR009057Homeodomain-like
SuperFamilySSF466895.2E-18215270IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-26216270IPR006447Myb domain, plants
PfamPF002496.8E-10218269IPR001005SANT/Myb domain
PfamPF143792.1E-25340387IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MPSSLPILPK PLKENFPRPH NPQHMPMPRQ LQNDSMPLHQ SSPQSATLHP RAGVVRSSYS  60
ATLGYSASPH DFVSNHEGQS IVAPFFSQSS NVEVFQSLSN NTPGGHAEAT WFPASVDGLP  120
DYTDNMTAPD NQIPSGSSNM TSDEIAKQNE WWAEIMDDDW KDILDATATD SQSKSMVQPS  180
NLAASQPAVN QSASSHSGEI CPVASPPNSN NASAAKQRMR WTPELHECFV DAVNQLGGSE  240
KATPKGVLKL MKVDGLTIYH VKSHLQKYRT ARYKPDLSEG ATEKRSTTDE LSLDLKTCIC  300
QIPPLLVLDS SRCILSPLCV HFYVGSEIIV LRLDYMRKSM DLTEALRLQM EVQKRLHEQL  360
EIQRKLQLRI EEQGKYLQMM FEKQCKSSTD KVQDPSSGDT ATPSSDPIHS ASKDSDAALD  420
PSRTGDNPGI AELGQNSTHV GGNQKTSETE SSDSLATAND GLFALEAQKL DIEISEPYWV  480
LQFPELLVYV VLNMNRWCLV FSPAWAPNQN SSSLTGLASQ LLGEFVRVER ARHGDLVVLG  540
VVVALDVLLL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-31215274160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001459G0190
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794590.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_025794591.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
SwissprotB8ANX90.0PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A2S3IR130.0A0A2S3IR13_9POAL; Uncharacterized protein
STRINGSi035682m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.15e-63phosphate starvation response 1