PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001316G0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 809aa    MW: 88964.4 Da    PI: 5.2503
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001316G0020genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP110.11.4e-34176250276
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                      Cqv gCe+d+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  PH01001316G0020 176 CQVSGCEEDIRELKGYHRRHRVCLRCAHAAAVMLDGVQKRYCQQCGKFHVLLDFDEDKRSCRRKLERHNKRRRRK 250
                      ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-26172237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.872173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.14E-32175253IPR004333Transcription factor, SBP-box
PfamPF031102.2E-26176250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MDVSGSGGGG SGSGADAGEH VWDWDNLLDF AFQDDDSLVL PWDDAIGIEA DPTEASPLPT  60
DPTPPQQPVE VEPEPEPVPP SPLQAGGSRR RVRKRDPRLV CPNYLAGRVP CACPEVDEMA  120
AAAEVEDVAT EMLAGARKKS KAAGRGSGAA ARGGGGGGGG GGSGGAGRGA AVEMGCQVSG  180
CEEDIRELKG YHRRHRVCLR CAHAAAVMLD GVQKRYCQQC GKFHVLLDFD EDKRSCRRKL  240
ERHNKRRRRK PDSKGTLEKE IDEQLELSAD GSGDGELREE NIDGTTCEML KTVLSNKVFD  300
RETPVGSEDG LSSPTCIQHN LQNDQNKSIV TFAASVEACL GTKQENAKLT NSPMHDTKSA  360
YSSSCPTGRI SFKLYDWNPA EFPRPLRNQI FEWLSSMPVE LEGYIRPGCT ILTVFIAMPQ  420
HMWDKLSEDA AILVRNLVNA PNSLLLGKGA FFFHVNNMIF QVLKDGATLM STRLEIQAPR  480
IHYVHPTWFE AGKPIELLLC GSSLDQPKFR SLLSFDGNYL KHDCCRLTSH ETFACVENVN  540
PILDSQHEIF QINITQSKPD THGPAFVEVE NMFGLSNFVP ILFGSKQLCF ELERIQDALC  600
GSSYKSVFGE FPGATSDPCD HRELQQTAMS GFLIDIGWLI RKPCPDEFKN VLSLTNIQRW  660
ICVLKFLIQN DFINVLEIIV KSLDNIIGSE ILSNLEMGRL EDHVTAFLGY VRHARNTVNH  720
RAKHDEKTLE TKWGSDSAPN QPNLGTSVPL AKENTDASSE YDLHSTNADC EEEETCVVLF  780
HPHRVGVLAA PVKRYLSSDS TIVDVKLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-34176257687squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232250KRSCRRKLERHNKRRRRKP
2236248RRKLERHNKRRRR
3243250NKRRRRKP
4244249KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001316G0020
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805456.10.0squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A3Q8AHQ60.0A0A3Q8AHQ6_9POAL; Squamosa-promoter binding protein-like protein
STRINGOGLUM05G17090.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-128squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]