PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001236G0110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 162aa    MW: 17519.5 Da    PI: 6.5101
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001236G0110genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.81.7e-5423118297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+ yv+p++ yl+kyreleg
  PH01001236G0110  23 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDGYVDPMRRYLHKYRELEG 116
                      89******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ++
  PH01001236G0110 117 DR 118
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5019124IPR009072Histone-fold
SuperFamilySSF471132.02E-3825124IPR009072Histone-fold
PfamPF008084.3E-272891IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.0E-175674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.0E-177593No hitNo description
PRINTSPR006154.0E-1794112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MADHHNQLGG SPDMAAAAGE EIKEQDRLLP IANVGRIMKQ ILPPNAKISK EAKETMQECV  60
SEFISFVTGE ASDKCHKEKR KTVNGDDVCW AFGALGFDGY VDPMRRYLHK YRELEGDRAA  120
AAASSRGGPD HPSTSGAGAS GTGHFMFNAM ERSDNNSSRQ F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4322113192Transcription factor HapC (Eurofung)
4g92_B3e-4322113192Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001236G0110
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2421181e-138AK242118.1 Oryza sativa Japonica Group cDNA, clone: J075146M01, full insert sequence.
GenBankHG6703061e-138HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635864.13e-80nuclear transcription factor Y subunit B-1
RefseqXP_015635872.13e-80nuclear transcription factor Y subunit B-1
SwissprotQ75IZ73e-56NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBLA2WYT19e-80A2WYT1_ORYSI; Uncharacterized protein
STRINGORUFI01G46550.11e-79(Oryza rufipogon)
STRINGOS01T0935200-011e-79(Oryza sativa)
STRINGORGLA01G0368700.11e-79(Oryza glaberrima)
STRINGOBART01G43130.11e-79(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-57nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SK, et al.
    OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice.
    Planta, 2016. 243(3): p. 563-76
    [PMID:26542958]