PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001167G0360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 178aa    MW: 18837.2 Da    PI: 8.335
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001167G0360genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP712.2e-2276122248
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                      C v+gC++dls+++eyhrrhkvCe+hsk+pvv++ g+eqrfCqqCs 
  PH01001167G0360  76 CSVDGCRSDLSQCREYHRRHKVCEAHSKTPVVVIGGQEQRFCQQCSS 122
                      *********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.3E-2370122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.27273150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.12E-2175127IPR004333Transcription factor, SBP-box
PfamPF031101.3E-1776126IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MDWAAASKAP SWGTTAAAAD SGPTMLSFAG PSSSSSSAAA AELQDFSVGI AQRARPAPAT  60
ARRARAPGGG GGAEACSVDG CRSDLSQCRE YHRRHKVCEA HSKTPVVVIG GQEQRFCQQC  120
SSKSTVKVHN PRDLEAQRSK LCPFDCTMIE SYNEKTKNNM HCLISTLVSE VSEIFLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A8e-1671121151squamosa promoter-binding protein-like 12
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001167G0360
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001352598.12e-48SBP-transcription factor 3
RefseqXP_008677048.14e-48squamosa promoter-binding protein-like (SBP domain) transcription factor family protein isoform X1
RefseqXP_008677050.12e-48squamosa promoter-binding protein-like (SBP domain) transcription factor family protein isoform X2
TrEMBLA0A3S6H5I42e-50A0A3S6H5I4_9POAL; Squamosa-promoter binding protein-like protein
STRINGPavir.J12729.1.p1e-49(Panicum virgatum)
STRINGGRMZM2G106798_P016e-48(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-20SBP family protein