PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001117G0310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Dof
Protein Properties Length: 318aa    MW: 33349.2 Da    PI: 8.3669
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001117G0310genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.45.6e-3775133361
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  PH01001117G0310  75 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 133
                      6779*************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3561132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.78978132IPR003851Zinc finger, Dof-type
PfamPF027016.2E-3278132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MIFPPAFLDS SGWNTNQLQP PTSNNITGPS AVAGGEGNLH QDQDGLATAA GTLPEGGGDG  60
SAMERARLAR IPRPEPGLKC PRCDSTNTKF CYFNNYSLSQ PRHFCRACRR YWTRGGALRN  120
VPVGGGYRRH AKRAKPKATA SATAAASASA VSSTTPSTCT TVAPTLHAML SNNASSLLPP  180
LHRFTDFDTG SLGLSFPGAA KLFADTAAGY AAGGGSSVQG MEQQWRAQAQ MQSFPFLHAM  240
DHQMGPATAM PTAMAMQGMF HLGLESGGGG FNSEDGGEFH VMPTKREEYP RGMYGDVSGY  300
TSYSSSTAGA VTVTIDY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ1835521e-94GQ183552.1 Oryza sativa Japonica Group Dof-type zinc finger protein 25 gene, partial cds.
GenBankAC0793561e-94AC079356.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0016H04, complete sequence.
GenBankAP0149611e-94AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankAK1089331e-94AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638255.13e-79PREDICTED: dof zinc finger protein DOF3.6
TrEMBLA0A0E0KXP53e-83A0A0E0KXP5_ORYPU; Uncharacterized protein
STRINGLOC_Os05g02150.11e-78(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.13e-39OBF-binding protein 3