PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001038G0580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Dof
Protein Properties Length: 272aa    MW: 27978.3 Da    PI: 8.7474
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001038G0580genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1001.5e-31100147249
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnv 49 
                      +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrn+
  PH01001038G0580 100 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNI 147
                      56789******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3184147IPR003851Zinc finger, Dof-type
PfamPF027011.7E-27104147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.884104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWNQQQQ QQAHHGQLPS GGGGGGVDAH AHHHQQHQLP PVPPPGALMA  60
PRPDMAAAVA VSGGGGPTGG SAVRLGSMTE RARLAKIPQP EPGLKCPRCE STNTKFCYFN  120
NYSLSQPRHF CKTCRRYWTR GGALRNIQQF PFLSRTDAMP PPMSGIYQFD AEGAADAAGF  180
AGQMLAGSKV PGSVGLITQL ASVKMEDNPP STAMTSASPR EFLGLPGNLQ FWGGGNGAGG  240
NGGSASGGAV APGGGWADLS GFNSSSSGNI L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126112e-84CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC1044332e-84AC104433.8 Oryza sativa chromosome 3 BAC OJ1754_E06 genomic sequence, complete sequence.
GenBankAP0149592e-84AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644382.11e-67PREDICTED: dof zinc finger protein DOF3.6-like
SwissprotQ9M2U15e-38DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A096SE481e-67A0A096SE48_MAIZE; Uncharacterized protein
STRINGGRMZM2G144188_P013e-67(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.16e-35OBF-binding protein 3