PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000978G0590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 203aa    MW: 21909.6 Da    PI: 5.0308
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000978G0590genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB36.31.3e-111171634894
            NF-YB  48 seasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      s+a+d c++ kr+tin+dd+l al ++ f ++vepl++ l+++r+ +
  PH01000978G0590 117 SDANDMCKESKRQTINADDVLKALDEMEFPEFVEPLRTSLQEFRNKN 163
                      78******************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-63486IPR009072Histone-fold
SuperFamilySSF471132.51E-63786IPR009072Histone-fold
SuperFamilySSF471136.16E-15117198IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.1E-18117201IPR009072Histone-fold
SuperFamilySSF471132.51E-6119142IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MAGETKEGES QPQAAQGEGT KPAPAAAVAM TEAEVEDLPK AIVRRLVKDK LAQIATGGAA  60
EVIVNKDAMA AFAESARIFI HYLSATSVPH SLPFHSSAPS NSCSLFSVCV YGVREKSDAN  120
DMCKESKRQT INADDVLKAL DEMEFPEFVE PLRTSLQEFR NKNAVKRSGT SKKQAEKRRK  180
LDKESLPQEP NDAADDAKAD ED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000978G0590
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0055461e-56AP005546.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1003_C09.
GenBankAP0149651e-56AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-56CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006661566.12e-78PREDICTED: DNA polymerase epsilon subunit 3-like
TrEMBLJ3N0A35e-77J3N0A3_ORYBR; Uncharacterized protein
STRINGOB09G26820.19e-78(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104143744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27470.15e-28nuclear factor Y, subunit B11