PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000969G0180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 293aa    MW: 32014.6 Da    PI: 6.8486
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000969G0180genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP483.3e-1535654878
                     SEEETTT--SS--S-STTTT-------S--- CS
              SBP 48 rfhelsefDeekrsCrrrLakhnerrrkkqa 78
                      fh l efDe+krsCr+rL++hn+rrrk+q+
  PH01000969G0180 35 WFHLLAEFDEAKRSCRKRLDGHNRRRRKPQP 65
                     6***************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114111.93163IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.9E-123568IPR004333Transcription factor, SBP-box
PfamPF031104.9E-83662IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.5E-43650IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MIDYLSQTPS GAKLDHHTDT AWRLYQVLLS VPIGWFHLLA EFDEAKRSCR KRLDGHNRRR  60
RKPQPDNMNS GSFMTSQQGT RFASFAPPRP EVSWSGIIKS EDSPYYTHQV LSNRQHFVGS  120
TSTYSKEGRR FPFLQEGDQI SFSTSATLEI SVCQPLLKTV APPPESSSSN KIFSDGLTQV  180
LDSDCALSLL SSPANSSSVE VSRMVQPTEH IPMAQSLVPN LQFGSSSWFA CSQASSGVST  240
AGFTCPSMDN GHLNTVLVPS SNGNEMNYHG IFHVGAEASS DGTSPSLPFS WQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14562KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000969G0180
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1087591e-39AC108759.2 Oryza sativa (Japonica cultiva-group) chromosome 9 BAC clone OSJNBa0072P02, complete sequence.
GenBankAP0149651e-39AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-39CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803089.11e-137squamosa promoter-binding-like protein 18 isoform X2
SwissprotQ0J0K11e-102SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A3Q8AVT80.0A0A3Q8AVT8_9POAL; Squamosa-promoter binding protein-like protein
STRINGBRADI4G34667.11e-128(Brachypodium distachyon)
STRINGPavir.J30793.1.p1e-128(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-15SBP family protein