PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000915G0320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 1062aa    MW: 116840 Da    PI: 7.3035
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000915G0320genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.32.5e-39127202378
                      SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   3 qvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       v++C+adl++ak+yhrrhkvCe+hsk++++lv+ ++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  PH01000915G0320 127 DVDDCRADLTNAKDYHRRHKVCEIHSKTTKALVASQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 202
                      699**********************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114130.257123200IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-35127203IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.4E-29127187IPR004333Transcription factor, SBP-box
PfamPF031101.5E-28128199IPR004333Transcription factor, SBP-box
PROSITE profilePS500888.63891912IPR002110Ankyrin repeat
PROSITE profilePS502978.534891912IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1062 aa     Download sequence    Send to blast
MQREVGPQVA PPLFMHQIQS LPPHAAAAKK RGHPWPAGAA VAPSAKTAAE PGGGGGNWNP  60
RMWDWDSRAL TAKPSSDAIR LSSGQSQEQQ PAAAAAKADE ALRQGGGGSG GLSLQLGLRE  120
EAATAMDVDD CRADLTNAKD YHRRHKVCEI HSKTTKALVA SQMQRFCQQC SRFHPLSEFD  180
EGKRSCRRRL AGHNRRRRKT QPTDVASQLL LPGNQENAGD RTHDIVNLIT VIARLQGSNV  240
GKLPSIPPIP DKDNLVQIIS KINSMNNASS VAKSPPSEVV DLNASHGQQQ DSVQKTTNGI  300
DKQTAPTMDL LAVLSTALAA PTPETNTSQS QGSSDSSGNN KTKSHSTEPA SVVNSHDKSI  360
RVFPAAGMIR SNSTQESPPE IYKQSDREPH LSLQLFGSTA EDIPPKMDTA NKYLSSESSN  420
PLDERSPSSS PPITHKFFPI RSVAEDIRHP HIADYGEDAG TVEVSTSRAW CAPPLELLKD  480
SERPIENGSP PNPAYQSCYA STSCSDHSPS TSNSDGQDRT GRIIFKLFGK EPGTIPGNLH  540
DEIVNWLKHS PSEMEGYIRP GCLVLSMYLL MPAIAWDELE ENLLQRVNTL VQSSDLDFWR  600
KGRFLVRTDT QLVSYKDGTA RLSKSWRTWN TPELTFVSPI AVVGGRKTSL VLKGRNLTIP  660
GTQIHCTRTG KYISKEVLCS AYPGTIYDDS GVETFDLPGE PHLIIGRCFI EVENRFRGNS  720
FPVIVANSSV CQELRNLEAE LVDSRFLDVS SDDQVHSARR LKPRDHVLHF LNELGWLFQK  780
AAACTPSTKS DISDSDLIQF STARFKYLLL FSNERDWCSL TKALLDILAK RSLVSDELSQ  840
ETLEMLSEIH LLNRAVKRKS SRMVHLLVQF VVICPDNSRL YPFLPNFPGP SGLTPLHLAA  900
SIDDAEEIVD ALTDDPQQIG LSCWHSVLDD DGQSPETYAK LRNNHLYNEL VAQKLVDRKN  960
SQVTIMVNKE EIHVDAGNVG ENNTSGIQAL QIRSCNQCAI LESGRLLKRP LHSRGLLARP  1020
YIHSMLAIAA VCVCVCVFMR ALLRFNSGRS FKWERLDFGT I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-30105199184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000915G0320
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024316742.10.0squamosa promoter-binding-like protein 15 isoform X2
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLA0A3S6H6380.0A0A3S6H638_9POAL; Squamosa-promoter binding protein-like protein (Fragment)
STRINGEMT214560.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14