PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000896G0440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 324aa    MW: 34264.3 Da    PI: 8.3994
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000896G0440genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS244.93.2e-75732351374
             GRAS  51 arlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRi 144
                      +r+a       ++ p+++ ++   +e+ a  +l+++ sP+++++  +aN a+ +    ++++H +Dfd+s + Q +aL+++La R+ +  sl++
  PH01000896G0440   7 SRIAP-----TASAPSQHLADLCGAEQRAGSQLLHQNSPCFRLALHAANIAVTD----HRTIHLVDFDVSVP-QHAALIHQLAGRRVPGTSLKV 90 
                      44443.....22222233332236666667799****************98765....79**********98.99******************* PP

             GRAS 145 Tgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksl 234
                      T+v +p+s      + +l ++gerL+k Ae++g++ +f+v v+ r ++le ++L ++pgEalaVnl+++l +++de+vs +++rde+L+ v+ l
  PH01000896G0440  91 TAVTDPTSPftqsLTATLPAVGERLKKQAERVGIEYRFEV-VSCRAAELEASKLGCEPGEALAVNLAFALSHVPDETVSPANPRDELLRRVRAL 183
                      *****99888877778899********************9.7999************************************************* PP

             GRAS 235 sPkvvvvveqeadhnsesFlerflealeyysalfdsl..eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                       P+vvv+veqe++ n++++++rf++a+ +y a+++sl  +a+l+res +r+  E++ l++++ n+v  ega+r er+e ++kWr+rl++aGF+p
  PH01000896G0440 184 GPQVVVLVEQELNSNTAPLATRFSDACAHYGAILESLdaNATLGRESADRARAEAA-LAKKAANAVGREGADRLERCEVFGKWRARLGMAGFRP 276
                      *************************************5556699***********9.9************************************ PP

             GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      vp+s  +a+q+ + l      g  v+ e+g l lgW++r ++++SaWr
  PH01000896G0440 277 VPVSPGIADQVMAGLGLAL-PGLAVKPENGVLRLGWMGRVVTVASAWR 323
                      ***************9998.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.9491304IPR005202Transcription factor GRAS
PfamPF035141.1E-727323IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVAVLSSRIA PTASAPSQHL ADLCGAEQRA GSQLLHQNSP CFRLALHAAN IAVTDHRTIH  60
LVDFDVSVPQ HAALIHQLAG RRVPGTSLKV TAVTDPTSPF TQSLTATLPA VGERLKKQAE  120
RVGIEYRFEV VSCRAAELEA SKLGCEPGEA LAVNLAFALS HVPDETVSPA NPRDELLRRV  180
RALGPQVVVL VEQELNSNTA PLATRFSDAC AHYGAILESL DANATLGRES ADRARAEAAL  240
AKKAANAVGR EGADRLERCE VFGKWRARLG MAGFRPVPVS PGIADQVMAG LGLALPGLAV  300
KPENGVLRLG WMGRVVTVAS AWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-29532351375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7291720.0KP729172.1 Stipa purpurea microsatellite ZH29 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLM0YRP70.0M0YRP7_HORVD; Uncharacterized protein
STRINGMLOC_72117.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.17e-76SCARECROW-like 8