PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000616G0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MIKC_MADS
Protein Properties Length: 190aa    MW: 21505.2 Da    PI: 10.2441
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000616G0020genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.42.8e-261058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   r vtf+kRr+g+lKKA+ELSvLCda+v viifss+gkl+e +
  PH01000616G0020 10 RIENPVHRRVTFCKRREGLLKKAKELSVLCDADVGVIIFSSQGKLHELA 58
                     9*********************************************965 PP

2K-box38.74.3e-1481170998
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +++ +++  +  +  L++ei  Lq  +R   G + ++++l  L++Le+ Le  + + R +K++++ ++i+ l++k+  l+ +n+ L++k+
  PH01000616G0020  81 NKALQNQVAEPRILLLREEIGLLQCGLRSTFGGGAGDMTLDKLHELEKGLELWIYQMRYTKMQIMQQEIQFLKNKQGILKAANEILQAKV 170
                      444455556666889************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.777161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-28177IPR002100Transcription factor, MADS-box
CDDcd002652.07E-37378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-26323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.62286176IPR002487Transcription factor, K-box
PfamPF014861.6E-1489170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MVRGKVQMQR IENPVHRRVT FCKRREGLLK KAKELSVLCD ADVGVIIFSS QGKLHELATN  60
GNMQSLVERY QSNAEGSQMA NKALQNQVAE PRILLLREEI GLLQCGLRST FGGGAGDMTL  120
DKLHELEKGL ELWIYQMRYT KMQIMQQEIQ FLKNKQGILK AANEILQAKV TLNRNFVIFA  180
WKISMIGLT*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000616G0020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1777001e-146AY177700.1 Oryza sativa (japonica cultivar-group) transcription factor MADS33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878024.12e-96MADS-box transcription factor 33 isoform X4
SwissprotQ2QW551e-95MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0E0BQC55e-95A0A0E0BQC5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0J7X25e-95A0A0E0J7X2_ORYNI; Uncharacterized protein
TrEMBLA2ZIY85e-95A2ZIY8_ORYSI; Uncharacterized protein
TrEMBLA3CFV15e-95A3CFV1_ORYSJ; Uncharacterized protein
STRINGOGLUM12G07130.18e-96(Oryza glumipatula)
STRINGONIVA12G05620.18e-96(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-52AGAMOUS-like 12