PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000608G0740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 429aa    MW: 45043.3 Da    PI: 7.8731
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000608G0740genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP47.93.5e-152332664477
                      TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP  44 qqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      q  s fh l efDe+krsCr+rL +hn+rrrk++
  PH01000608G0740 233 QYDSGFHVLAEFDEAKRSCRKRLTEHNRRRRKPT 266
                      66799***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114111.511186265IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.2E-4233252IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.9E-11233267IPR004333Transcription factor, SBP-box
PfamPF031101.2E-7237264IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MMSGRLDTGT VAPATDVVAD FAYAPMQPYV GFDPGMAAMP NDRPPLLQNH LYDNLDFAAA  60
AFSFQEPALL SAGWVSNALQ HLAPQITMPM APSPLQVPMM TLPGVPTAAD AYPFGVGGLV  120
KRDNGPVVDV GGGSFGLNLG RRTYFSPADV LAVDRLLMRS GSAASVPWAC WGSDSARPTT  180
SSRRGARPTA ARPTSPPLST TTAATRSAST TPRPPPSPAA ASSSASASNA AVQYDSGFHV  240
LAEFDEAKRS CRKRLTEHNR RRRKPTSAQA KDSPPPSKKA ATSIASSYTS DHKTASTMVA  300
SKSAAISPNA SGISCLELDN VQTSNTAAAP TTLSLVAPPP PPHDKDGLDY TMLMMQQVQG  360
REEQQHFMLT SLVQPSHQYN SSSNNNNDRG SGNGNILSCS SVSDQQNSSC NGGSNSCSSM  420
HFFEVDFM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1247264KRSCRKRLTEHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000608G0740
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020149100.11e-103squamosa promoter-binding-like protein 5
TrEMBLA0A3Q8B3780.0A0A3Q8B378_BAMOL; Squamosa-promoter binding protein-like protein
STRINGSb04g005180.18e-87(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.19e-11squamosa promoter binding protein-like 3