PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000548G0610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 304aa    MW: 32688.5 Da    PI: 7.088
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000548G0610genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.96.6e-24237283248
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                      CqvegC+ dls++k+yhr+h+vCe+hskap+v+v+gle+rfCqqCsr
  PH01000548G0610 237 CQVEGCKIDLSSVKDYHRKHRVCEAHSKAPKVVVAGLERRFCQQCSR 283
                      **********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-24229285IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.563234303IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-23236284IPR004333Transcription factor, SBP-box
PfamPF031107.9E-19237286IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDGEVATVVG EMREWEVVEQ AQRRKWVLVG MVRQPGSSFE IQVGAEAEIF ISGMGSFGMD  60
WNQKSSELWD WENLLPISTN ADENPKNVMH AEPKFAGVAA AMGHESVHSS GGTFSSSSEM  120
GYGSPKSSIY ASIDSSSKVG KNTEFKFATV KEPDKNIGKK TELSKVDDTG NSPTSVVAVS  180
SGEPVIGLKL GKRTYFEDVC GGQNVKSSPS GASAVTPSTA FAKKAKVAQQ NTQNSYCQVE  240
GCKIDLSSVK DYHRKHRVCE AHSKAPKVVV AGLERRFCQQ CSRGQRASIY LQSTGGEDEN  300
NPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-17237283652squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000548G0610
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646870.11e-104PREDICTED: squamosa promoter-binding-like protein 3
SwissprotA2X0Q61e-97SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z81e-97SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A3S6H5Y31e-165A0A3S6H5Y3_9POAL; Squamosa-promoter binding protein-like protein
STRINGLPERR02G02980.11e-104(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-36squamosa promoter binding protein-like 2