PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000542G0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family G2-like
Protein Properties Length: 237aa    MW: 26040.3 Da    PI: 7.1959
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000542G0010genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.34.7e-303989151
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                     k+r+rWtpe He+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQ
  PH01000542G0010 39 KQRMRWTPEHHECFVDAVNQLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQ 89
                     79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7953696IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-283790IPR009057Homeodomain-like
SuperFamilySSF466899.68E-163893IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-223990IPR006447Myb domain, plants
PfamPF002498.6E-84189IPR001005SANT/Myb domain
PfamPF143796.2E-26109156IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MVQPSNLTAS QPAISQSASS HSGEICPVAS PPSNASAAKQ RMRWTPEHHE CFVDAVNQLG  60
GSEKATPKGV LKLMKVDGLT IYHVKSHLQV QQKKMSSTDE LSLDLKTSMD LTEALRLQME  120
VQKRLHEQLE IQRKLQLRIE EQGKYLQMMF EKQCKSSTEK VQDPSSVDTA APSSDPSHSA  180
SKDSDAALDP NRTGDNPGIA ELGPNSTPVG GNQKTSDYGL QTYKQYYMIR LRITDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-243889152Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000542G0010
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8315333e-67JF831533.1 Zea mays isolate A phosphate starvation protein (PHR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794590.11e-120protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
RefseqXP_025794591.11e-120protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
SwissprotB8ANX91e-107PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
SwissprotQ10LZ11e-107PHR1_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A2T7CD291e-119A0A2T7CD29_9POAL; Uncharacterized protein
STRINGPavir.Ia03429.1.p1e-117(Panicum virgatum)
STRINGPavir.J39104.1.p1e-118(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.34e-55G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]