PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000464G0680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 171aa    MW: 18096.4 Da    PI: 7.383
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000464G0680genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.51.9e-5823119197
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+yveplk+yl+kyre+e
  PH01000464G0680  23 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYVEPLKIYLHKYREME 116
                      69******************************************************************************************** PP

            NF-YB  95 gek 97 
                      g++
  PH01000464G0680 117 GDS 119
                      *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-5422127IPR009072Histone-fold
SuperFamilySSF471131.1E-4026123IPR009072Histone-fold
PfamPF008081.3E-282993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.7E-225775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.7E-227694No hitNo description
PRINTSPR006152.7E-2295113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MADGGGSPDS GSPRGGGGGG GGVREQDRFL PIANISRIMK KAVPANGKIA KDAKETLQEC  60
VSEFISFVTS EASDKCQKEK RKTINGDDLL WAMATLGFEE YVEPLKIYLH KYREMEGDSK  120
LSSKAGDGSV KKDAIGPHAG SSSSSAQGMV QHGAYTQGMG YMQPQWLCIC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4822114193NF-YB
4awl_B3e-4822114294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4822114294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000464G0680
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0944620.0FP094462.1 Phyllostachys edulis cDNA clone: bphyst012k19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564550.11e-100nuclear transcription factor Y subunit B-3
SwissprotP252092e-89NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLI1HT461e-98I1HT46_BRADI; Uncharacterized protein
STRINGBRADI2G54200.12e-99(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-69nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Li XY, et al.
    Evolutionary variation of the CCAAT-binding transcription factor NF-Y.
    Nucleic Acids Res., 1992. 20(5): p. 1087-91
    [PMID:1549471]