PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000450G0480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 524aa    MW: 56863.2 Da    PI: 8.5852
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000450G0480genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.62.1e-3950127178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqve+C ++l  ak yhr+h+vCe+hsk+p v+v+g+e+rfCqqCsrfh+lsefD++krsCr+rL++hn+rrrk+q+
  PH01000450G0480  50 RCQVEDCGVELGGAKGYHRKHRVCEAHSKCPRVVVAGQERRFCQQCSRFHALSEFDQNKRSCRKRLSDHNARRRKPQP 127
                      6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3144112IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.41948125IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.55E-3849130IPR004333Transcription factor, SBP-box
PfamPF031107.4E-3051124IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MEWTPRPAPC PSSPLMWDWD ATAGEEESGV KRGKQQQGGG VAGAGEGEAR CQVEDCGVEL  60
GGAKGYHRKH RVCEAHSKCP RVVVAGQERR FCQQCSRFHA LSEFDQNKRS CRKRLSDHNA  120
RRRKPQPDVF SFVSAVLPSS LFGNVFVSYR DDRREISFVL NKAPLSDVNP FPYSSWPSGF  180
KLSQVLDVGE KSIKAGAVNG QIHLPKSNIS NSLPTLYHDI DELLPIKAAN AKLARKSIPG  240
PREHISCRHL SLVRATGGRT SLVHTTLVRT TLLLPRPHLP GADRKSMTRQ PDAAGCPNHG  300
RADTARTVLV RTKEVRTRRQ QCCAHQGGAD EACLAACGAD EAEVAARITI LKAIAKSEFA  360
NPSSKPIPLD IHEELHGNIC CYILCMFLFL IFGFSTVSPN FDGTHASVNF AGADASGAAS  420
KLDGAPDVRH ALSLLSASSW GSTDPVQKTS SFIQFADANQ NSMISHVSNG GNSNSPFWID  480
GQPLAPESQV VQFTVDTGST AFQDLKRIKP AYDSTLFSMN QIH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-23511241184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000450G0480
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0945090.0FP094509.1 Phyllostachys edulis cDNA clone: bphyst033c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.11e-88squamosa promoter-binding-like protein 4
TrEMBLA0A3Q8AYS57e-89A0A3Q8AYS5_9POAL; Squamosa-promoter binding protein-like protein
STRINGPavir.Ab00499.1.p7e-89(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.43e-36squamosa promoter-like 11