PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000399G0890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YB
Protein Properties Length: 276aa    MW: 31471.7 Da    PI: 4.7481
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000399G0890genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB48.71.8e-1521811373
            NF-YB 13 vsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalat 73
                     + +i+k++lP + ++++da++++ ec +efi +++se+++ c re++kti+++ +l al +
  PH01000399G0890 21 MFKIIKEMLPPDVRVARDAQDLLVECCVEFINLLSSESNEVCSREEKKTIAPEHVLKALQH 81
                     578*****************************************************99864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471138.06E-201981IPR009072Histone-fold
Gene3DG3DSA:1.10.20.108.9E-222081IPR009072Histone-fold
PfamPF008087.8E-182279IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.3E-4112173IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEYSVINRET FGGIIDYNST MFKIIKEMLP PDVRVARDAQ DLLVECCVEF INLLSSESNE  60
VCSREEKKTI APEHVLKALQ HYVNMLSKIK DMIYILSIFC ELKIKITECL GTDLGFREYI  120
EEVYAAYEQH KLDTLDSPKA SKFTGVEMTE EEAVAEQQRM FAEARARMNN GAAKPKEQEA  180
EPQQPPQPQL QLHPQPQQPL QPQLQLHPQP QQPPQLLLHP QPQQPQQQLH SQPQQPPQLQ  240
LQPQEQAQPQ PQPQPQPLSQ PQPLSQPQTE HGLDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-231916519133Transcription Regulator NC2 beta chain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000399G0890
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8415648e-68CT841564.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C104G12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235094.18e-93nuclear transcription factor Y subunit beta
SwissprotP495923e-58NC2B_ARATH; Protein Dr1 homolog
TrEMBLI1I6Q32e-91I1I6Q3_BRADI; Uncharacterized protein
STRINGBRADI3G34930.13e-92(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-61nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]