PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000369G0400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 719aa    MW: 79021.3 Da    PI: 5.4372
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000369G0400genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.21.3e-1063357091373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a +lL++++++a p+gd+ qRla++++e+L+arl++++s+ +   ++  +++++ ++ l+a++l+  +  + k+s
  PH01000369G0400 335 LRTLLIHCAQAVATDDRRSAMELLKQIKQHALPRGDAAQRLAHCLAEGLQARLVGTGSTGSLVHESLMAKRTSAVDILQAYQLYMAAICFKKVS 428
                      6789***************************************************65555544455555556699******************* PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  N++I++a  g++++HiiD++i++G+QWp++l++++ R++gpp++RiTg++ p++g   ++++eetg+rL+++A+e++vpf++++++a ++
  PH01000369G0400 429 FIFSNHTIYNASLGKKKIHIIDYGIQYGFQWPCFLKKISGREGGPPEVRITGIDLPQPGfrPTQRIEETGRRLSNYAREFDVPFKYHAIAAAKM 522
                      **********************************************************9******************************999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+++ e+L+++p+E+l+Vn++ q ++l+desv ++s+rd vL+ +++++P+ ++++  + + +++ F++rf eal yysa+fd l+++ prese
  PH01000369G0400 523 ESVRKEDLNIDPDEVLIVNCQCQFKNLMDESVVIDSPRDIVLNNIRKMQPHAFIHAIVNGSFSAPFFVTRFREALFYYSAMFDILDTTTPRESE 616
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      +r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl+ ++++ ++  +++++ + + ++ ++++l++gWk+r L+++S W
  PH01000369G0400 617 QRMLIEQNIFGRSALNVIACEGTDRVERPETYKQWQVRNQRAGLKQLPLNPDIVQVVRDKVKRCYHKDFVIDVDHQWLLQGWKGRILYAISTW 709
                      *****************************************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.797309690IPR005202Transcription factor GRAS
PfamPF035144.5E-104335709IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MGSSSHLPAV PGAGDDADPS LFFYLSDLTP ASPSAYLDLP PTPHQEQPGG GSPSSSATED  60
LVLPFISRML MEEDIDDKFF YDYPDHPALL QAQQPFLDIL SDPSSQSNSS DSNSNNNHLS  120
PSDASVSTAA AVNSYDPARF TSIDPDPAAF FGGGANSDFM SSAFLKGMEE ANKFLPSEDK  180
LVIDLEASSG EFLRGVEEAK KFLPSEDKLL IGFNGVSAPA AAPAALVSVK KEAVDAVVVA  240
AAGGGRGRKN PYDDEELELE GGRSSKQTAV QGDDVAAQDM FHEVMMPTQE MCVLQMQNLR  300
LAMEKEAASN EASGGGKGGN GKARGRRGGK DVVDLRTLLI HCAQAVATDD RRSAMELLKQ  360
IKQHALPRGD AAQRLAHCLA EGLQARLVGT GSTGSLVHES LMAKRTSAVD ILQAYQLYMA  420
AICFKKVSFI FSNHTIYNAS LGKKKIHIID YGIQYGFQWP CFLKKISGRE GGPPEVRITG  480
IDLPQPGFRP TQRIEETGRR LSNYAREFDV PFKYHAIAAA KMESVRKEDL NIDPDEVLIV  540
NCQCQFKNLM DESVVIDSPR DIVLNNIRKM QPHAFIHAIV NGSFSAPFFV TRFREALFYY  600
SAMFDILDTT TPRESEQRML IEQNIFGRSA LNVIACEGTD RVERPETYKQ WQVRNQRAGL  660
KQLPLNPDIV QVVRDKVKRC YHKDFVIDVD HQWLLQGWKG RILYAISTWV ANDASSYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-413397098374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0E0MNV80.0A0A0E0MNV8_ORYPU; Uncharacterized protein
STRINGLOC_Os12g38490.10.0(Oryza sativa Japonica Group)
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-156GRAS family protein