PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000328G0180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GeBP
Protein Properties Length: 308aa    MW: 32954.8 Da    PI: 5.6792
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000328G0180genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57356.48.3e-18501182997
           DUF573  29 spsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                          d++ fy+ +++s+   +++sql+eK+rrLKkKf++ ++++++g +p+  ++hd+++++l++++W+
  PH01000328G0180  50 VFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKKKFRNVSARVARGLDPARLAPHDRDVLHLCSRLWD 118
                      4556****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.0E-1653118IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MASDQTLPLP PVIPAPPNPD QITTPTAPIA DPTPPSASAG LLGCGAQGLV FPRDLNVFYD  60
RFSESMPQPY TRSQLSEKLR RLKKKFRNVS ARVARGLDPA RLAPHDRDVL HLCSRLWDHA  120
NAATSPFADN AGTSGNKRRR ANPRGGAAPP LELPAPSGDS NSHDYNGISS STPGAFPSDG  180
TGEDMMYLEQ ESAHLYDIEG AVLVADGILD GITKEQPDTV AALPSIGYNG VGNENGNCKV  240
VAPRSNKHRM ANAVLDVFEE CLREANANGS AEDSELAKRW RAQRIDEFDV LSRRLRLLIE  300
DAAAAGN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0944720.0FP094472.1 Phyllostachys edulis cDNA clone: bphylf057n04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231034.11e-145PREDICTED: uncharacterized protein LOC100845859
TrEMBLI1GP541e-145I1GP54_BRADI; Uncharacterized protein
STRINGBRADI1G11200.11e-144(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.14e-11DNA-binding storekeeper protein-related transcriptional regulator