PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000256G0700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TCP
Protein Properties Length: 154aa    MW: 16063.6 Da    PI: 11.3212
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000256G0700genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP56.41.2e-176498640
              TCP  6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLG 40
                      r+ ++hTkv+gR+RR+R+sa caar+F+L++eLG
  PH01000256G0700 64 PRNHDRHTKVEGRGRRIRMSAACAARIFQLTRELG 98
                     6899******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136910.74266120IPR017887Transcription factor TCP subgroup
PfamPF036341.6E-136698IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MEAQVQDKAE EEESARLHAQ PGGVGCGVAA AMAIGAIPMH SFIVPKPEPV EFFGGMAMIR  60
KPPPRNHDRH TKVEGRGRRI RMSAACAARI FQLTRELGPT GHGGARGLLP VIANPLLQSS  120
GGAAISVPSG LAPITATATP TRPRPSLRCL GHR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000256G0700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0605362e-64AK060536.1 Oryza sativa Japonica Group cDNA clone:001-021-D02, full insert sequence.
GenBankAK1026662e-64AK102666.1 Oryza sativa Japonica Group cDNA clone:J033101L16, full insert sequence.
GenBankAK1196602e-64AK119660.1 Oryza sativa Japonica Group cDNA clone:002-130-H12, full insert sequence.
GenBankAP0046322e-64AP004632.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0623F08.
GenBankAP0149642e-64AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126162e-64CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankD872612e-64D87261.1 Oryza sativa Japonica Group mRNA for PCF2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664491.37e-38transcription factor PCF2
SwissprotA2YXQ14e-38PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH64e-38PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A317Y4S85e-38A0A317Y4S8_MAIZE; Transcription factor PCF2
STRINGGRMZM2G107031_P018e-38(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.11e-15TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]