PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000237G0810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family VOZ
Protein Properties Length: 669aa    MW: 73417.9 Da    PI: 5.2674
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000237G0810genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ417.32.6e-1283015181217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p+ps++lgpkc+lwdc rp++gse++qdyc+ +ha laln+ g +gt+pv+rp+gidlkdg+lfaal ak+qgk+vgip+cegaatakspwna+
  PH01000237G0810 301 PSPSQYLGPKCSLWDCGRPVRGSEECQDYCNPYHAGLALNDdGFLGTRPVMRPRGIDLKDGPLFAALCAKIQGKNVGIPVCEGAATAKSPWNAP 394
                      89**************************************9799************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdlslle+e++rewlffd+prrafesgnrkqrslpdysgrgwhesrkqvmk+fgglkrsyymdpqp+s++ewhl+eyein++dalalyrlel
  PH01000237G0810 395 ELFDLSLLEAESLREWLFFDTPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKDFGGLKRSYYMDPQPTSNYEWHLFEYEINDSDALALYRLEL 488
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d+k+sak+k++ +sl+++q++++rl+a
  PH01000237G0810 489 KSSDAKRSAKSKLAGSSLNEIQQQMVRLSA 518
                      ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MAGDPSSGGG GHGSAPGKGS RSSSRHRQFR DRAKTRVDDL QEMFSGLQSA RKESRSVDAA  60
LLEEQVHQML REWRAELSVA SPACSLQAHL QTLTSPYALR RLLYLTCLHG GLQNSQGNNR  120
EASDPPSETL RLLQLAVAEE EDDATSRLVV PQSPLPMPPS HQSHGHGQDG QSLNPELQVQ  180
GEAVAGGATV SQQSLGQQMQ GDCGGEVASA TNAMFNDQIY YIDHELSIDD FLRDDDYKIN  240
LPGLNPDDLN NLQGIGQLEH QQFNLPLDLP PPNSYVDANN SARNTGDVFS HMSDLLTTVC  300
PSPSQYLGPK CSLWDCGRPV RGSEECQDYC NPYHAGLALN DDGFLGTRPV MRPRGIDLKD  360
GPLFAALCAK IQGKNVGIPV CEGAATAKSP WNAPELFDLS LLEAESLREW LFFDTPRRAF  420
ESGNRKQRSL PDYSGRGWHE SRKQVMKDFG GLKRSYYMDP QPTSNYEWHL FEYEINDSDA  480
LALYRLELKS SDAKRSAKSK LAGSSLNEIQ QQMVRLSADS PVENKRTARS RPKTNQKDTN  540
ANTYPALNTP NQASPSNAYH AVSQNTPNQA SPSNTYQAVS LNTPNQASPS NAYQAVSLNT  600
PNQASASNAY QAVSLNNPNQ VNDPNAYQAV SQVDQMTFLN ENVVYGPHLP YGYFTERSDF  660
YWNPSDGT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000237G0810
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0690760.0AK069076.1 Oryza sativa Japonica Group cDNA clone:J023004H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654646.10.0PREDICTED: transcription factor VOZ1-like
TrEMBLA0A0E0DTW30.0A0A0E0DTW3_9ORYZ; Uncharacterized protein
STRINGOMERI05G19650.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-137vascular plant one zinc finger protein