PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000236G1170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Nin-like
Protein Properties Length: 915aa    MW: 100881 Da    PI: 6.3993
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000236G1170genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.33.2e-28594644252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  PH01000236G1170 594 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 644
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.654583664IPR003035RWP-RK domain
PfamPF020426.7E-26596644IPR003035RWP-RK domain
SuperFamilySSF542776.73E-21808902No hitNo description
Gene3DG3DSA:3.10.20.2401.3E-22814897No hitNo description
PROSITE profilePS5174520.844816899IPR000270PB1 domain
SMARTSM006664.3E-20816899IPR000270PB1 domain
PfamPF005642.6E-15817898IPR000270PB1 domain
CDDcd064073.75E-37817897No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 915 aa     Download sequence    Send to blast
MEQQPPPSDE DGLLGCGMSM AGDMAGVDLD LMEEFLLAPG FDFSEFLFPA AAGAFSPGPS  60
PFSPLFDIGS SAATATPPAP AGEDDRDEAE RPSWLEASPV RRAWLFQPTQ ETAEPTGAGA  120
RRVAVAVAVA AGAGRAAGAG VLTTCGQPFW LDRRNDRLAS YRTVSMKYQL SVDESARAEL  180
GLPGRVFVGR VPEWTPDVRY FSTEEYPRVR HAQHFDIRGS VALPVFERRS RACLGVVELV  240
MTTQKINYNA DIENICNALK EVDLRSSDVS SDPRAKVVDT SYRAIVPEII DVLRAVCETH  300
KLPLAQTWIL CACQAKRGIR HSDDKYKYCV STVDEACYVR DPTVIGFHQA CSEHHLFRGE  360
GVVGRAFGTK EPCFSPDITA YSKVQYPLSH YAKLFCLRAA VAIRLRSVRT GSLDFVLEFF  420
LPMNCIKSEE QRAMLNSLSI TIQQVCYTLR VVSVKELVND ESFENSVPTL PEFYAKSMPE  480
NLDELCRSIN APARTTSMEA SEVSSWIASL VDAQNKEAKG EIDADLPFGF SKQKDEGFSV  540
TAGWRTSPVL APEASIFSEF KQHEEYDVKG ATCSGDPSLS NLDKAVEKRH TKMEKTVSLQ  600
DLRKHFAGSL KEAAKNLGVC PTTLKRICRQ HGINRWPSRK IKKVGHSLKK LQMVIDSVHG  660
AEGTVQLSSL YENFTKTTWS ERELHGDLPF PASEQTVHLE PSVPGRLCEG RFTSHTSGSN  720
SLSPSCSQSS NSSLRCSSGP KPQQQHGSAP QLAIKQEISM EENQSSTLMK AGSHAELQMF  780
TEERPVTLSR SQSHMLLSEH KPMENMSSMQ KAKPDSLKIK AMYAEERCVF RLQSSWGFQK  840
LKEDITKRFG IAQGTYVDLK YLDDESEWVL LTCDADLLEC IDVYKSSSAK TVRILVNSTV  900
QPVLGGSYGQ TGLS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000236G1170
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629744.10.0protein NLP1
RefseqXP_015629745.10.0protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLL0P2L80.0L0P2L8_9POAL; PH01B031C15.15 protein
STRINGOS03T0131100-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]