PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000227G0940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Whirly
Protein Properties Length: 230aa    MW: 25325.8 Da    PI: 10.3998
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000227G0940genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly182.39.3e-57541912139
           Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                      v+k+kaal++++++p+f++l+sg  +++++G+++l++ +a+++rkyd+ kkq fals+tev++l++l++ esceffhdp++k+s+eG+v+k+l 
  PH01000227G0940  54 VFKGKAALSIHPILPNFGKLESGGSRVNKNGSVMLTFFPAVGQRKYDYTKKQLFALSPTEVGSLISLGPAESCEFFHDPSMKSSHEGQVKKSLT 147
                      9********************************************************************************************* PP

           Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                      + Pl + sG+f+n++v n+ +k+ e++svPv+kaefav+r++l+
  PH01000227G0940 148 ITPLGNDSGYFLNITVLNNAQKTTERLSVPVTKAEFAVMRTALS 191
                      *****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.9E-7344211IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.2E-7445230IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.3E-5854188IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MLRLSRFLPS TSRRVSDLKD ALWSGSLTFQ HAVSTSTANL DVTTSGRKFA SYTVFKGKAA  60
LSIHPILPNF GKLESGGSRV NKNGSVMLTF FPAVGQRKYD YTKKQLFALS PTEVGSLISL  120
GPAESCEFFH DPSMKSSHEG QVKKSLTITP LGNDSGYFLN ITVLNNAQKT TERLSVPVTK  180
AEFAVMRTAL SFALPHIMGW DQVLTNHHPS PSSASKPRVE RPHPDSEWER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A6e-74462029165StWhy2
3n1i_A6e-74462029165protein StWhy2
3n1j_A6e-74462029165Protein StWhy2
3n1k_A6e-74462029165protein StWhy2
3n1l_A6e-74462029165protein StWhy2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000227G0940
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0991330.0FP099133.1 Phyllostachys edulis cDNA clone: bphyem106m01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627387.11e-150single-stranded DNA-binding protein WHY2, mitochondrial
SwissprotD9J0344e-77WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A0E0JVS81e-149A0A0E0JVS8_ORYPU; Uncharacterized protein
STRINGOS02T0158400-011e-149(Oryza sativa)
STRINGORGLA02G0041200.11e-149(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.18e-75WHIRLY 2