PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000226G1160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Dof
Protein Properties Length: 239aa    MW: 24274 Da    PI: 9.5554
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000226G1160genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof92.82.8e-2978132560
           zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       ++cprC s+ntkfCyynn+s +qPry+CkaCrr+Wt+GG+lr+vP Gggrrknk+
  PH01000226G1160  78 PRQCPRCWSANTKFCYYNNHSRAQPRYLCKACRRHWTEGGTLRDVP-GGGRRKNKR 132
                      679*******************************************.999***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-2779132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.19579133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-1684123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MSSSFLASYS SSASSPLSSQ IPTPPPPPPP PLVGHGYATN GVSVGVQTSG VDAASAAGAA  60
PRQGSRHAGH PPLPRPPPRQ CPRCWSANTK FCYYNNHSRA QPRYLCKACR RHWTEGGTLR  120
DVPGGGRRKN KRGGGKGGAK AASTATASAT AVATVSSVGG ADAFPDILRQ MLFHPAAAIG  180
GGGSSIDLSA WQQMPAATTP QGTGDVGPVG GTAPDANCGG VQYWNGWQQD DMPGLDGAC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0934390.0FP093439.1 Phyllostachys edulis cDNA clone: bphylf045o17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614315.13e-59PREDICTED: dof zinc finger protein DOF3.1
TrEMBLA0A0E0BC731e-59A0A0E0BC73_9ORYZ; Uncharacterized protein
STRINGBGIOSGA031626-PA3e-58(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.13e-18Dof family protein