PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000219G0080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Dof
Protein Properties Length: 423aa    MW: 45105.5 Da    PI: 7.7052
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000219G0080genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3988147261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  PH01000219G0080  88 PDKILPCPRCNSMDTKFCYFNNYNVHQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 147
                      7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3085145IPR003851Zinc finger, Dof-type
PfamPF027016.6E-3290146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.77992146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MGECRGGDCS IKLFGKTIPV PEAGDVAKDL QHSVSSSTES DDQESTHQDN ADPTPRPEVV  60
DAEDPAAADK SSSPQSGDAA NQEKLKKPDK ILPCPRCNSM DTKFCYFNNY NVHQPRHFCK  120
NCQRYWTAGG AMRNVPVGAG RRKNKNAVAA SHFLQRVRAA LPGDPLCGPP VKTNGTVLSF  180
GHDASALDLA EHMSHLKEKL VPIGGRAGNS GDNPSMGSCS EVSSNRDDKN QSNSNEKVTV  240
EKSANGVQHP SMNGATMWPY SCAPSPAYYT SGIAIPIYPA APAYWGCMVP GAWSLPWPVQ  300
SQSPALSSPT SAPSVSSGPN YLTLGKHPRE GDEGRIHGNG KVWVPKTIRI DNADEVARSS  360
IWSLIGIKGD KEETATGGHK LATVFEPKCE PKMAKHTVIT SLPLLHANPV ALTRSVTFQE  420
GS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9567847e-91EU956784.1 Zea mays clone 1573856 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573898.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLI1I3V10.0I1I3V1_BRADI; Uncharacterized protein
STRINGBRADI3G25670.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-55cycling DOF factor 2